Western Blot (WB)
(Western blot - IL1B Polyclonal Antibody. Western blot analysis of extracts of various cell lines, using IL1B antibody .Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Rabbit IL-1 beta Polyclonal Antibody | anti-IL-1beta antibody
IL-1 beta Rabbit pAb
Gene Names
IL1B; IL-1; IL1F2; IL1-BETA
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
IL-1 beta; Polyclonal Antibody; IL-1 beta Rabbit pAb; IL1B; IL-1; IL1-BETA; IL1F2; interleukin-1 beta; anti-IL-1beta antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
Rabbit IgG
Specificity
Expressed in activated monocytes/macrophages (at protein level).
Purity/Purification
Affinity purified
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Applicable Applications for anti-IL-1beta antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 124-223 of human IL1B (NP_000567.1).CTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEIN
Positive Control
U-937, Rat thymus, A-549, Mouse liver, Mouse spleen, Rat spleen
Conjugation
Unconjugated
Modification
Unmodified
Cell Position
Cytoplasm, Cytoplasmic vesicle, Lysosome, Secreted, autophagosome, cytosol, exosome
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot - IL1B Polyclonal Antibody. Western blot analysis of extracts of various cell lines, using IL1B antibody .Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Western Blot (WB)
(Western blot - IL1B Polyclonal Antibody. Western blot analysis of extracts of various cell lines, using IL1B antibody .Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Western Blot (WB)
(Western blot - IL1B Polyclonal Antibody. Western blot analysis of extracts of various cell lines, using IL1B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Exposure time: 10s.)
Western Blot (WB)
(Western blot - IL1B Polyclonal Antibody. Western blot analysis of extracts of various cell lines, using IL1B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Exposure time: 10s.)
Related Product Information for anti-IL-1beta antibody
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
Product Categories/Family for anti-IL-1beta antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 30 kDa; Observed: 36 kDa
NCBI Official Full Name
interleukin-1 beta proprotein
NCBI Official Synonym Full Names
interleukin 1, beta
NCBI Official Symbol
IL1B
NCBI Official Synonym Symbols
IL-1; IL1F2; IL1-BETA
NCBI Protein Information
interleukin-1 beta; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta
UniProt Protein Name
Interleukin-1 beta
UniProt Gene Name
IL1B
UniProt Synonym Gene Names
IL1F2; IL-1 beta
UniProt Entry Name
IL1B_HUMAN
Similar Products
Product Notes
The IL-1beta il1b (Catalog #AAA4757680) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL-1 beta Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IL-1 beta can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the IL-1beta il1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL-1 beta, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
