Western Blot (WB)
(Host: RabbitTarget Name: CHMP4BSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse CHMP4B Polyclonal Antibody | anti-CHMP4B antibody
CHMP4B Antibody-C-terminal region
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHMP4B; Polyclonal Antibody; CHMP4B Antibody-C-terminal region; charged multivesicular body protein 4b; C76846; Snf7-2; 2010012F05Rik; anti-CHMP4B antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
ELEELEQEELDKNLLEISGPETVPLPNVPSVALPSKPAKKKEEEDDDMKE
Applicable Applications for anti-CHMP4B antibody
Western Blot (WB)
Protein Size
224 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse CHMP4B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CHMP4BSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CHMP4BSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CHMP4B antibody
Description of Target: Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. Together with SPAST, the ESCRT-III complex promotes nuclear envelope sealing and mitotic spindle disassembly during late anaphase. Plays a role in the endosomal sorting pathway. ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. When overexpressed, membrane-assembled circular arrays of CHMP4B filaments can promote or stabilize negative curvature and outward budding. CHMP4A/B/C are required for the exosomal release of SDCBP, CD63 and syndecan.
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
25kDa
UniProt Protein Name
Charged multivesicular body protein 4b
Protein Family
UniProt Gene Name
Chmp4b
UniProt Synonym Gene Names
CHMP4b
UniProt Entry Name
CHM4B_MOUSE
Similar Products
Product Notes
The CHMP4B chmp4b (Catalog #AAA3249834) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHMP4B Antibody-C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CHMP4B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHMP4B chmp4b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ELEELEQEEL DKNLLEISGP ETVPLPNVPS VALPSKPAKK KEEEDDDMKE. It is sometimes possible for the material contained within the vial of "CHMP4B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
