Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PHLPP2Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 2ug/ml)

Rabbit anti-Human PHLPP2 Polyclonal Antibody | anti-PHLPP2 antibody

PHLPP2 Antibody-C-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PHLPP2; Polyclonal Antibody; PHLPP2 Antibody-C-terminal region; PH domain leucine-rich repeat-containing protein phosphatase 2; UBC; USP12; WDR20; WDR48; PPP3CA; SNX27; USP46; PHLPP1; VAT1; SLC9A3R1; SLC9A3R2; EZR; USP1; RDX; PHLPPL; anti-PHLPP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
PVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYP
Applicable Applications for anti-PHLPP2 antibody
Western Blot (WB)
Protein Size
1256 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PHLPP2
Predicted Homology Based on Immunogen Sequence
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PHLPP2Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 2ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PHLPP2Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 2ug/ml)
Related Product Information for anti-PHLPP2 antibody
Description of Target: Protein phosphatase involved in regulation of Akt and PKC signaling. Mediates dephosphorylation in the C-terminal domain hydrophobic motif of members of the AGC Ser/Thr protein kinase family; specifically acts on 'Ser-473' of AKT1, 'Ser-660' of PRKCB isoform beta-II and 'Ser-657' of PRKCA. Akt regulates the balance between cell survival and apoptosis through a cascade that primarily alters the function of transcription factors that regulate pro- and antiapoptotic genes. Dephosphorylation of 'Ser-473' of Akt triggers apoptosis and decreases cell proliferation. Also controls the phosphorylation of AKT3. Dephosphorylates STK4 on 'Thr-387' leading to STK4 activation and apoptosis. Dephosphorylates RPS6KB1 and is involved in regulation of cap-dependent translation. Inhibits cancer cell proliferation and may act as a tumor suppressor. Dephosphorylation of PRKCA and PRKCB leads to their destabilization and degradation. Dephosphorylates RAF1 inhibiting its kinase activity.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
138kDa
UniProt Protein Name
PH domain leucine-rich repeat-containing protein phosphatase 2
UniProt Gene Name
PHLPP2
UniProt Synonym Gene Names
KIAA0931; PHLPPL; PHLPP-like
UniProt Entry Name
PHLP2_HUMAN

Uniprot Description

PHLPP2: Protein phosphatase that mediates dephosphorylation of 'Ser-473' of AKT1, 'Ser-660' of PRKCB isoform beta-II and 'Ser- 657' of PRKCA. AKT1 regulates the balance between cell survival and apoptosis through a cascade that primarily alters the function of transcription factors that regulate pro- and antiapoptotic genes. Dephosphorylation of 'Ser-473' of AKT1 triggers apoptosis and decreases cell proliferation. Also controls the phosphorylation of AKT3. Dephosphorylation of PRKCA and PRKCB leads to their destabilization and degradation. Inhibits cancer cell proliferation and may act as a tumor suppressor. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein phosphatase, Ser/Thr (non-receptor); EC 3.1.3.16; Tumor suppressor

Chromosomal Location of Human Ortholog: 16q22.2

Cellular Component: photoreceptor inner segment; cytoplasm; nucleus; cytosol

Molecular Function: metal ion binding; protein serine/threonine phosphatase activity

Biological Process: epidermal growth factor receptor signaling pathway; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; innate immune response; protein amino acid dephosphorylation

Similar Products

Product Notes

The PHLPP2 phlpp2 (Catalog #AAA3249608) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PHLPP2 Antibody-C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PHLPP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PHLPP2 phlpp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PVPLSKVFSL EQDPEEAQRV KDQKAIITED NKVNGVTCCT RMLGCTYLYP. It is sometimes possible for the material contained within the vial of "PHLPP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.