Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TRPM3Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 3ug/ml)

Rabbit anti-Human TRPM3 Polyclonal Antibody | anti-TRPM3 antibody

TRPM3 Antibody-middle region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRPM3; Polyclonal Antibody; TRPM3 Antibody-middle region; Transient receptor potential cation channel subfamily M member 3; GON-2; MLSN2; LTRPC3; anti-TRPM3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
VACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQ
Applicable Applications for anti-TRPM3 antibody
Western Blot (WB)
Protein Size
1732 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRPM3
Predicted Homology Based on Immunogen Sequence
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TRPM3Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 3ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TRPM3Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 3ug/ml)
Related Product Information for anti-TRPM3 antibody
Description of Target: The product of this gene belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
190kDa
UniProt Protein Name
Transient receptor potential cation channel subfamily M member 3
UniProt Gene Name
TRPM3
UniProt Synonym Gene Names
KIAA1616; LTRPC3; LTrpC-3; LTrpC3; MLSN2
UniProt Entry Name
TRPM3_HUMAN

Similar Products

Product Notes

The TRPM3 trpm3 (Catalog #AAA3249596) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRPM3 Antibody-middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRPM3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRPM3 trpm3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VACKLCKAMA HEASENDMVD DISQELNHNS RDFGQLAVEL LDQSYKQDEQ. It is sometimes possible for the material contained within the vial of "TRPM3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.