SERPINA3G blocking peptide
SERPINA3G Peptide - middle region
Gene Names
Serpina3g; 2A2; spi2; Spi2A; Spi2-1; AI119734; Spi2/eb.1
Reactivity
Mouse
Synonyms
SERPINA3G; SERPINA3G Peptide - middle region; SERPINA3G blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GKWKNPFDPNDTFKSEFYLDEKRSVIVSMMKTGYLTTPYFRDEELSCTVV
Sequence Length
440
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SERPINA3G blocking peptide
This is a synthetic peptide designed for use in combination with anti- SERPINA3G Antibody, made
Target Description: Serine and cysteine protease inhibitor. Can inhibit lysosomal papain-like proteases including the cathepsins B, G, H, K, L and V. Ineffective against elastase, granzyme A, granzyme B, or caspases 3, 8 or 9. Inhibition of cytoplasmic cathepsin B following release from the lysosome may protect cells from apoptosis. This may facilitate the survival of progenitor T-cells and the subsequent development of long term memory CD8 T-cells.
Target Description: Serine and cysteine protease inhibitor. Can inhibit lysosomal papain-like proteases including the cathepsins B, G, H, K, L and V. Ineffective against elastase, granzyme A, granzyme B, or caspases 3, 8 or 9. Inhibition of cytoplasmic cathepsin B following release from the lysosome may protect cells from apoptosis. This may facilitate the survival of progenitor T-cells and the subsequent development of long term memory CD8 T-cells.
Product Categories/Family for SERPINA3G blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Full Name
serine protease inhibitor A3G
NCBI Official Synonym Full Names
serine (or cysteine) peptidase inhibitor, clade A, member 3G
NCBI Official Symbol
Serpina3g
NCBI Official Synonym Symbols
2A2; spi2; Spi2A; Spi2-1; AI119734; Spi2/eb.1
NCBI Protein Information
serine protease inhibitor A3G
UniProt Protein Name
Serine protease inhibitor A3G
Protein Family
UniProt Gene Name
Serpina3g
UniProt Synonym Gene Names
Spi2A; Serpin A3G; Serpin 2A
Uniprot Description
Serine and cysteine protease inhibitor. Can inhibit lysosomal papain-like proteases including the cathepsins B, G, H, K, L and V. Ineffective against elastase, granzyme A, granzyme B, or caspases 3, 8 or 9. Inhibition of cytoplasmic cathepsin B following release from the lysosome may protect cells from apoptosis. This may facilitate the survival of progenitor T-cells and the subsequent development of long term memory CD8 T-cells.
Research Articles on SERPINA3G
Similar Products
Product Notes
The SERPINA3G serpina3g (Catalog #AAA3248363) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SERPINA3G Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GKWKNPFDPN DTFKSEFYLD EKRSVIVSMM KTGYLTTPYF RDEELSCTVV. It is sometimes possible for the material contained within the vial of "SERPINA3G, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
