Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CD80 blocking peptide

CD80 Peptide - middle region

Gene Names
Cd80; B71; Ly53; TSA1; Cd28l; Ly-53; MIC17
Reactivity
Mouse
Synonyms
CD80; CD80 Peptide - middle region; CD80 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRG
Sequence Length
306
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CD80 blocking peptide
This is a synthetic peptide designed for use in combination with anti- CD80 Antibody, made

Target Description: Involved in the costimulatory signal essential for T lymphocytes activation. T-cell proliferation and cytokine production is induced by the binding of CD28 or CTLA-4 to this receptor.
Product Categories/Family for CD80 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
T-lymphocyte activation antigen CD80
NCBI Official Synonym Full Names
CD80 antigen
NCBI Official Symbol
Cd80
NCBI Official Synonym Symbols
B71; Ly53; TSA1; Cd28l; Ly-53; MIC17
NCBI Protein Information
T-lymphocyte activation antigen CD80
UniProt Protein Name
T-lymphocyte activation antigen CD80
UniProt Gene Name
Cd80
UniProt Synonym Gene Names
B7; B7

Uniprot Description

CD80: Involved in the costimulatory signal essential for T- lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28 or CTLA-4 to this receptor.

Protein type: Immunoglobulin superfamily; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16 B4|16 26.86 cM

Cellular Component: cell surface; external side of plasma membrane

Molecular Function: protein binding

Biological Process: positive regulation of alpha-beta T cell proliferation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of T cell proliferation; T cell costimulation

Research Articles on CD80

Similar Products

Product Notes

The CD80 cd80 (Catalog #AAA3248157) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CD80 Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: DRIYWQKHDK VVLSVIAGKL KVWPEYKNRT LYDNTTYSLI ILGLVLSDRG. It is sometimes possible for the material contained within the vial of "CD80, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.