Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

LSM4 blocking peptide

LSM4 Peptide - C-terminal region

Gene Names
LSM4; GRP; YER112W
Reactivity
Human
Synonyms
LSM4; LSM4 Peptide - C-terminal region; LSM4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: AKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGR
Sequence Length
139
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for LSM4 blocking peptide
This is a synthetic peptide designed for use in combination with anti- LSM4 Antibody, made

Target Description: This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for LSM4 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15 kDa
NCBI Official Full Name
U6 snRNA-associated Sm-like protein LSm4 isoform 1
NCBI Official Synonym Full Names
LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated
NCBI Official Symbol
LSM4
NCBI Official Synonym Symbols
GRP; YER112W
NCBI Protein Information
U6 snRNA-associated Sm-like protein LSm4
UniProt Protein Name
U6 snRNA-associated Sm-like protein LSm4
Protein Family
UniProt Gene Name
LSM4
UniProt Synonym Gene Names
GRP
UniProt Entry Name
LSM4_HUMAN

NCBI Description

This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

LSM4: Binds specifically to the 3'-terminal U-tract of U6 snRNA. Belongs to the snRNP Sm proteins family.

Protein type: RNA-binding; Spliceosome

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: small nuclear ribonucleoprotein complex; spliceosome; cytosol

Molecular Function: protein binding

Biological Process: RNA splicing; gene expression; mRNA processing; mRNA catabolic process, deadenylation-dependent decay

Research Articles on LSM4

Similar Products

Product Notes

The LSM4 lsm4 (Catalog #AAA3248048) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The LSM4 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKGRGRGGLQ QQKQQKGRGM GGAGRGVFGG RGRGGIPGTG RGQPEKKPGR. It is sometimes possible for the material contained within the vial of "LSM4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.