Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using LSM4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 5s.)
Rabbit anti-Human LSM4 Polyclonal Antibody | anti-LSM4 antibody
LSM4 Polyclonal Antibody
Gene Names
LSM4; GRP; YER112W
Reactivity
Human
Applications
Western Blot, Immunofluorescence, Immunoprecipitation
Purity
Affinity Purification
Synonyms
LSM4; Polyclonal Antibody; LSM4 Polyclonal Antibody; GRP; YER112W; anti-LSM4 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
Sequence Length
139
Applicable Applications for anti-LSM4 antibody
Western Blot (WB), Immunofluorescence (IF), Immunoprecipitation (IP)
Application Notes
WB: 1:500 - 1:2000
IF: 1:50 - 1:200
IP: 1:20 - 1:50
IF: 1:50 - 1:200
IP: 1:20 - 1:50
Immunogen
Recombinant protein of human LSM4
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using LSM4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 5s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using LSM4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 5s.)
Immunoprecipitation (IP)
(Immunoprecipitation analysis of 200ug extracts of Jurkat cells using 1ug LSM4 antibody. Western blot was performed from the immunoprecipitate using LSM4 antibody at a dilition of 1:1000.)
Immunoprecipitation (IP)
(Immunoprecipitation analysis of 200ug extracts of Jurkat cells using 1ug LSM4 antibody. Western blot was performed from the immunoprecipitate using LSM4 antibody at a dilition of 1:1000.)
Related Product Information for anti-LSM4 antibody
This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-LSM4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 15kDa
Observed: 14kDa
Observed: 14kDa
NCBI Official Full Name
U6 snRNA-associated Sm-like protein LSm4 isoform 1
NCBI Official Synonym Full Names
LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated
NCBI Official Symbol
LSM4
NCBI Official Synonym Symbols
GRP; YER112W
NCBI Protein Information
U6 snRNA-associated Sm-like protein LSm4
UniProt Protein Name
U6 snRNA-associated Sm-like protein LSm4
Protein Family
UniProt Gene Name
LSM4
UniProt Synonym Gene Names
GRP
NCBI Description
This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]
Uniprot Description
Binds specifically to the 3'-terminal U-tract of U6 snRNA.
Research Articles on LSM4
Similar Products
Product Notes
The LSM4 lsm4 (Catalog #AAA9133623) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LSM4 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LSM4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF), Immunoprecipitation (IP). WB: 1:500 - 1:2000 IF: 1:50 - 1:200 IP: 1:20 - 1:50. Researchers should empirically determine the suitability of the LSM4 lsm4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLPLSLLKTA QNHPMLVELK NGETYNGHLV SCDNWMNINL REVICTSRDG DKFWRMPECY IRGSTIKYLR IPDEIIDMVK EEVVAKGRGR GGLQQQKQQK GRGMGGAGRG VFGGRGRGGI PGTGRGQPEK KPGRQAGKQ. It is sometimes possible for the material contained within the vial of "LSM4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
