Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SRD5A1 blocking peptide

SRD5A1 Peptide - middle region

Gene Names
SRD5A1; S5AR 1
Reactivity
Human
Synonyms
SRD5A1; SRD5A1 Peptide - middle region; SRD5A1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYA
Sequence Length
259
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SRD5A1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- SRD5A1 Antibody, made

Target Description: Steroid 5-alpha-reductase catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2.
Product Categories/Family for SRD5A1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29 kDa
NCBI Official Full Name
3-oxo-5-alpha-steroid 4-dehydrogenase 1 isoform 1
NCBI Official Synonym Full Names
steroid 5 alpha-reductase 1
NCBI Official Symbol
SRD5A1
NCBI Official Synonym Symbols
S5AR 1
NCBI Protein Information
3-oxo-5-alpha-steroid 4-dehydrogenase 1
UniProt Protein Name
3-oxo-5-alpha-steroid 4-dehydrogenase 1
UniProt Gene Name
SRD5A1
UniProt Synonym Gene Names
S5AR 1
UniProt Entry Name
S5A1_HUMAN

NCBI Description

Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306).[supplied by OMIM, Mar 2008]

Uniprot Description

SRD5A1: Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5- alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology. Belongs to the steroid 5-alpha reductase family.

Protein type: Lipid Metabolism - androgen and estrogen; Membrane protein, integral; Oxidoreductase; Membrane protein, multi-pass; EC 1.3.1.22

Chromosomal Location of Human Ortholog: 5p15

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: electron carrier activity; cholestenone 5-alpha-reductase activity; 3-oxo-5-alpha-steroid 4-dehydrogenase activity

Biological Process: steroid metabolic process; sex determination; androgen biosynthetic process; cell differentiation; sex differentiation

Research Articles on SRD5A1

Similar Products

Product Notes

The SRD5A1 srd5a1 (Catalog #AAA3247055) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SRD5A1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GMLINIHSDH ILRNLRKPGD TGYKIPRGGL FEYVTAANYF GEIMEWCGYA. It is sometimes possible for the material contained within the vial of "SRD5A1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.