Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

C5AR2 blocking peptide

GPR77 Peptide - C-terminal region

Gene Names
C5AR2; C5L2; GPF77; GPR77
Reactivity
Human
Synonyms
C5AR2; GPR77 Peptide - C-terminal region; C5AR2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: CLNPMLFLYFGRAQLRRSLPAACHWALRESQGQDESVDSKKSTSHDLVSE
Sequence Length
337
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for C5AR2 blocking peptide
This gene encodes a G-protein coupled receptor 1 family member involved in the complement system of the innate immune response. Unlike classical G-protein coupled receptors, the encoded protein does not associate with intracellular G-proteins. It may instead modulate signal transduction through the beta-arrestin pathway, and may alternatively act as a decoy receptor. This gene may be involved in coronary artery disease and in the pathogenesis of sepsis. Alternative splicing results in multiple transcript variants.
Product Categories/Family for C5AR2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa
NCBI Official Full Name
C5a anaphylatoxin chemotactic receptor 2
NCBI Official Synonym Full Names
complement component 5a receptor 2
NCBI Official Symbol
C5AR2
NCBI Official Synonym Symbols
C5L2; GPF77; GPR77
NCBI Protein Information
C5a anaphylatoxin chemotactic receptor 2
UniProt Protein Name
C5a anaphylatoxin chemotactic receptor 2
UniProt Gene Name
C5AR2
UniProt Synonym Gene Names
C5L2; GPR77
UniProt Entry Name
C5AR2_HUMAN

NCBI Description

This gene encodes a G-protein coupled receptor 1 family member involved in the complement system of the innate immune response. Unlike classical G-protein coupled receptors, the encoded protein does not associate with intracellular G-proteins. It may instead modulate signal transduction through the beta-arrestin pathway, and may alternatively act as a decoy receptor. This gene may be involved in coronary artery disease and in the pathogenesis of sepsis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]

Uniprot Description

C5AR2: Receptor for the chemotactic and inflammatory C3a, C4a and C5a anaphylatoxin peptides and also for their dearginated forms ASP/C3adesArg, C4adesArg and C5adesArg respectively. Couples weakly to G(i)-mediated signaling pathways. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: apical part of cell; integral to membrane; plasma membrane; basal plasma membrane

Molecular Function: protein binding; C5a anaphylatoxin receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; negative regulation of tumor necrosis factor production; inflammatory response; chemotaxis; positive regulation of epithelial cell proliferation

Research Articles on C5AR2

Similar Products

Product Notes

The C5AR2 c5ar2 (Catalog #AAA3246936) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The GPR77 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: CLNPMLFLYF GRAQLRRSLP AACHWALRES QGQDESVDSK KSTSHDLVSE. It is sometimes possible for the material contained within the vial of "C5AR2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.