Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

MINPP1 blocking peptide

MINPP1 Peptide - middle region

Gene Names
MINPP1; MIPP; HIPER1; MINPP2
Reactivity
Human
Synonyms
MINPP1; MINPP1 Peptide - middle region; MINPP1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQ
Sequence Length
487
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for MINPP1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- MINPP1 Antibody, made

Target Description: This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway.
Product Categories/Family for MINPP1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
multiple inositol polyphosphate phosphatase 1 isoform 2
NCBI Official Synonym Full Names
multiple inositol-polyphosphate phosphatase 1
NCBI Official Symbol
MINPP1
NCBI Official Synonym Symbols
MIPP; HIPER1; MINPP2
NCBI Protein Information
multiple inositol polyphosphate phosphatase 1
UniProt Protein Name
Multiple inositol polyphosphate phosphatase 1
UniProt Gene Name
MINPP1
UniProt Synonym Gene Names
MIPP; 2,3-BPG phosphatase; Ins(1,3,4,5)P(4) 3-phosphatase
UniProt Entry Name
MINP1_HUMAN

NCBI Description

This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway.[provided by RefSeq, Sep 2009]

Uniprot Description

MINPP1: Acts as a phosphoinositide 5- and phosphoinositide 6- phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Also acts as a 2,3-bisphosphoglycerate 3-phosphatase, by mediating the dephosphorylation of 2,3-bisphosphoglycerate (2,3-BPG) to produce phospho-D-glycerate without formation of 3- phosphoglycerate. May play a role in bone development (endochondral ossification). Defects in MINPP1 may be involved in follicular thyroid tumors development. Belongs to the histidine acid phosphatase family. MINPP1 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted; EC 3.1.3.80; Carbohydrate Metabolism - inositol phosphate; Motility/polarity/chemotaxis; EC 3.1.3.62; Hydrolase

Chromosomal Location of Human Ortholog: 10q23

Cellular Component: endoplasmic reticulum lumen; endoplasmic reticulum

Molecular Function: acid phosphatase activity; phosphohistidine phosphatase activity

Biological Process: polyphosphate metabolic process; ossification; inositol phosphate metabolic process; dephosphorylation; bone mineralization

Disease: Thyroid Carcinoma, Follicular

Research Articles on MINPP1

Similar Products

Product Notes

The MINPP1 minpp1 (Catalog #AAA3246782) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The MINPP1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: VKQIRKLRQL HGLLQARGSR DGGASSTGSR DLGAALADWP LWYADWMDGQ. It is sometimes possible for the material contained within the vial of "MINPP1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.