Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RND3 blocking peptide

RND3 Peptide - middle region

Gene Names
RND3; ARHE; Rho8; RhoE; memB
Reactivity
Human
Synonyms
RND3; RND3 Peptide - middle region; RND3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: AATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHM
Sequence Length
244
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RND3 blocking peptide
This is a synthetic peptide designed for use in combination with anti- RND3 Antibody, made

Target Description: This gene encodes a protein which is a member of the small GTPase protein superfamily. The encoded protein binds only GTP but has no GTPase activity, and appears to act as a negative regulator of cytoskeletal organization leading to loss of adhesion. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Product Categories/Family for RND3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
390
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26 kDa
NCBI Official Full Name
rho-related GTP-binding protein RhoE
NCBI Official Synonym Full Names
Rho family GTPase 3
NCBI Official Symbol
RND3
NCBI Official Synonym Symbols
ARHE; Rho8; RhoE; memB
NCBI Protein Information
rho-related GTP-binding protein RhoE
UniProt Protein Name
Rho-related GTP-binding protein RhoE
UniProt Gene Name
RND3
UniProt Synonym Gene Names
ARHE; RHO8; RHOE
UniProt Entry Name
RND3_HUMAN

NCBI Description

This gene encodes a protein which is a member of the small GTPase protein superfamily. The encoded protein binds only GTP but has no GTPase activity, and appears to act as a negative regulator of cytoskeletal organization leading to loss of adhesion. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Dec 2011]

Uniprot Description

RhoE: Binds GTP but lacks intrinsic GTPase activity and is resistant to Rho-specific GTPase-activating proteins. Binds ROCK1. Interacts with UBXD5. Ubiquitous. Belongs to the small GTPase superfamily. Rho family.

Protein type: G protein, monomeric; G protein, monomeric, Rho; G protein; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2q23.3

Cellular Component: Golgi membrane; focal adhesion

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: metabolic process; small GTPase mediated signal transduction; cell adhesion; actin cytoskeleton organization and biogenesis

Research Articles on RND3

Similar Products

Product Notes

The RND3 rnd3 (Catalog #AAA3246386) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RND3 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: AATYIECSAL QSENSVRDIF HVATLACVNK TNKNVKRNKS QRATKRISHM. It is sometimes possible for the material contained within the vial of "RND3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.