Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

MC3R blocking peptide

MC3R Peptide - N-terminal region

Gene Names
MC3R; MC3; OB20; OQTL; BMIQ9; MC3-R
Reactivity
Human
Synonyms
MC3R; MC3R Peptide - N-terminal region; MC3R blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGI
Sequence Length
323
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for MC3R blocking peptide
This is a synthetic peptide designed for use in combination with anti- MC3R Antibody, made

Target Description: This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans.
Product Categories/Family for MC3R blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
melanocortin receptor 3
NCBI Official Synonym Full Names
melanocortin 3 receptor
NCBI Official Symbol
MC3R
NCBI Official Synonym Symbols
MC3; OB20; OQTL; BMIQ9; MC3-R
NCBI Protein Information
melanocortin receptor 3
UniProt Protein Name
Melanocortin receptor 3
Protein Family
UniProt Gene Name
MC3R
UniProt Synonym Gene Names
MC3-R
UniProt Entry Name
MC3R_HUMAN

NCBI Description

This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans. [provided by RefSeq, Jul 2008]

Uniprot Description

MC3R: Receptor for MSH (alpha, beta and gamma) and ACTH. This receptor is mediated by G proteins which activate adenylate cyclase. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1

Chromosomal Location of Human Ortholog: 20q13.2-q13.3

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: neuropeptide binding; protein binding; melanocortin receptor activity; peptide hormone binding; melanocyte stimulating hormone receptor activity

Biological Process: G-protein signaling, coupled to cAMP nucleotide second messenger; G-protein signaling, coupled to cyclic nucleotide second messenger; regulation of heart rate; homoiothermy; regulation of blood pressure; positive regulation of cAMP biosynthetic process; sodium ion homeostasis; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); circadian regulation of gene expression

Disease: Body Mass Index Quantitative Trait Locus 9; Mycobacterium Tuberculosis, Susceptibility To

Research Articles on MC3R

Similar Products

Product Notes

The MC3R mc3r (Catalog #AAA3246298) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The MC3R Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: MNASCCLPSV QPTLPNGSEH LQAPFFSNQS SSAFCEQVFI KPEVFLSLGI. It is sometimes possible for the material contained within the vial of "MC3R, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.