Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: MC3RSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Rabbit anti-Human MC3R Polyclonal Antibody | anti-MC3R antibody

MC3R Antibody - C-terminal region

Gene Names
MC3R; MC3; OB20; OQTL; BMIQ9; MC3-R
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MC3R; Polyclonal Antibody; MC3R Antibody - C-terminal region; anti-MC3R antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCN
Sequence Length
323
Applicable Applications for anti-MC3R antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MC3R
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: MC3RSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: MC3RSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: MC3RSample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MC3RSample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MC3R antibody
This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans.
Product Categories/Family for anti-MC3R antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
melanocortin receptor 3
NCBI Official Synonym Full Names
melanocortin 3 receptor
NCBI Official Symbol
MC3R
NCBI Official Synonym Symbols
MC3; OB20; OQTL; BMIQ9; MC3-R
NCBI Protein Information
melanocortin receptor 3
UniProt Protein Name
Melanocortin receptor 3
Protein Family
UniProt Gene Name
MC3R
UniProt Synonym Gene Names
MC3-R
UniProt Entry Name
MC3R_HUMAN

NCBI Description

This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans. [provided by RefSeq, Jul 2008]

Uniprot Description

MC3R: Receptor for MSH (alpha, beta and gamma) and ACTH. This receptor is mediated by G proteins which activate adenylate cyclase. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1

Chromosomal Location of Human Ortholog: 20q13.2-q13.3

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: neuropeptide binding; protein binding; melanocortin receptor activity; peptide hormone binding; melanocyte stimulating hormone receptor activity

Biological Process: G-protein signaling, coupled to cAMP nucleotide second messenger; G-protein signaling, coupled to cyclic nucleotide second messenger; regulation of heart rate; homoiothermy; regulation of blood pressure; positive regulation of cAMP biosynthetic process; sodium ion homeostasis; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); circadian regulation of gene expression

Disease: Body Mass Index Quantitative Trait Locus 9; Mycobacterium Tuberculosis, Susceptibility To

Research Articles on MC3R

Similar Products

Product Notes

The MC3R mc3r (Catalog #AAA3221028) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MC3R Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MC3R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MC3R mc3r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PTNPYCICYT AHFNTYLVLI MCNSVIDPLI YAFRSLELRN TFREILCGCN. It is sometimes possible for the material contained within the vial of "MC3R, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.