Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

WDR48 blocking peptide

WDR48 Peptide - C-terminal region

Gene Names
WDR48; P80; UAF1; SPG60
Reactivity
Human
Synonyms
WDR48; WDR48 Peptide - C-terminal region; WDR48 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDPNMDLRTVK
Sequence Length
677
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for WDR48 blocking peptide
This is a synthetic peptide designed for use in combination with anti- WDR48 Antibody, made

Target Description: Regulator of deubiquitinating complexes. Acts as a strong activator of USP1 and USP46. Enhances the USP1-mediated deubiquitination of FANCD2; USP1 being almost inactive by itself. Also activates deubiquitinating activity of complexes containing USP12. Activates deubiquitination by increasing the catalytic turnover without increasing the affinity of deubiquitinating enzymes for the substrate. In case of infection by Herpesvirus saimiri, may play a role in vesicular transport or membrane fusion events necessary for transport to lysosomes. Induces lysosomal vesicle formation via interaction with Herpesvirus saimiri tyrosine kinase-interacting protein (TIP). Subsequently, TIP recruits tyrosine-protein kinase LCK, resulting in down-regulation of T-cell antigen receptor TCR. May play a role in generation of enlarged endosomal vesicles via interaction with TIP. In case of infection by papillomavirus HPV11, promotes the maintenance of the viral genome via its interaction with HPV11 helicase E1.
Product Categories/Family for WDR48 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74 kDa
NCBI Official Full Name
WD repeat-containing protein 48 isoform 2
NCBI Official Synonym Full Names
WD repeat domain 48
NCBI Official Symbol
WDR48
NCBI Official Synonym Symbols
P80; UAF1; SPG60
NCBI Protein Information
WD repeat-containing protein 48
UniProt Protein Name
WD repeat-containing protein 48
UniProt Gene Name
WDR48
UniProt Synonym Gene Names
KIAA1449; UAF1
UniProt Entry Name
WDR48_HUMAN

NCBI Description

The protein encoded by this gene has been shown to interact with ubiquitin specific peptidase 1 (USP1), activating the deubiquitinating activity of USP1 and allowing it to remove the ubiquitin moiety from monoubiquitinated FANCD2. FANCD2 is ubiquitinated in response to DNA damage. [provided by RefSeq, Sep 2016]

Uniprot Description

WDR48: an ubiquitous lysosomal WD40 repeat protein. May play a role in vesicular transport or membrane fusion events necessary for transport to lysosomes. Induces lysosomal vesicle formation via interaction with Herpesvirus saimiri tyrosine kinase-interacting protein (TIP). Subsequently, TIP recruits tyrosine-protein kinase LCK, resulting in down-regulation of T-cell antigen receptor TCR. May play a role in generation of enlarged endosomal vesicles via interaction with TIP.

Protein type: Ubiquitin conjugating system; Vesicle

Chromosomal Location of Human Ortholog: 3p21.33

Cellular Component: intracellular membrane-bound organelle; lysosome; nucleus

Molecular Function: protein binding

Biological Process: skin development; protein deubiquitination; viral reproduction; skeletal morphogenesis; single fertilization; multicellular organism growth; homeostasis of number of cells; embryonic organ development; spermatogenesis; double-strand break repair via homologous recombination; positive regulation of epithelial cell proliferation

Research Articles on WDR48

Similar Products

Product Notes

The WDR48 wdr48 (Catalog #AAA3246149) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The WDR48 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: NESQTTSSSN NEKPGEQEKE EDIAVLAEEK IELLCQDQVL DPNMDLRTVK. It is sometimes possible for the material contained within the vial of "WDR48, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.