Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

POLR1C blocking peptide

POLR1C Peptide - N-terminal region

Gene Names
POLR1C; AC40; RPA5; TCS3; HLD11; RPA39; RPA40; RPAC1; RPC40
Reactivity
Human
Applications
Western Blot
Synonyms
POLR1C; POLR1C Peptide - N-terminal region; POLR1C blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: FGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGI
Sequence Length
167
Applicable Applications for POLR1C blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for POLR1C blocking peptide
The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Defects in this gene have been associated with Treacher Collins syndrome (TCS).
Product Categories/Family for POLR1C blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
DNA-directed RNA polymerases I and III subunit RPAC1 isoform 1
NCBI Official Synonym Full Names
RNA polymerase I and III subunit C
NCBI Official Symbol
POLR1C
NCBI Official Synonym Symbols
AC40; RPA5; TCS3; HLD11; RPA39; RPA40; RPAC1; RPC40
NCBI Protein Information
DNA-directed RNA polymerases I and III subunit RPAC1
UniProt Protein Name
DNA-directed RNA polymerases I and III subunit RPAC1
UniProt Gene Name
POLR1C
UniProt Synonym Gene Names
POLR1E; DNA-directed RNA polymerase I subunit C; RNA polymerases I and III subunit AC1; RPA40
UniProt Entry Name
RPAC1_HUMAN

NCBI Description

The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Mutations in this gene have been associated with Treacher Collins syndrome (TCS) and hypomyelinating leukodystrophy 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Uniprot Description

RPA40: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft. Defects in POLR1C are the cause of Treacher Collins syndrome type 3 (TCS3). A form of Treacher Collins syndrome, a disorder of craniofacial development. Treacher Collins syndrome is characterized by a combination of bilateral downward slanting of the palpebral fissures, colobomas of the lower eyelids with a paucity of eyelashes medial to the defect, hypoplasia of the facial bones, cleft palate, malformation of the external ears, atresia of the external auditory canals, and bilateral conductive hearing loss. Belongs to the archaeal RpoD/eukaryotic RPB3 RNA polymerase subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription initiation complex; Nucleotide Metabolism - pyrimidine; Nucleotide Metabolism - purine; EC 2.7.7.6; Transferase

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: nucleoplasm; DNA-directed RNA polymerase III complex; cytosol; DNA-directed RNA polymerase I complex

Molecular Function: protein dimerization activity; DNA binding; DNA-directed RNA polymerase activity

Biological Process: transcription from RNA polymerase III promoter; termination of RNA polymerase III transcription; negative regulation of gene expression, epigenetic; positive regulation of interferon type I production; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; innate immune response; gene expression; termination of RNA polymerase I transcription; transcription initiation from RNA polymerase I promoter; regulation of gene expression, epigenetic; RNA elongation from RNA polymerase III promoter

Disease: Leukodystrophy, Hypomyelinating, 11; Treacher Collins Syndrome 3

Research Articles on POLR1C

Similar Products

Product Notes

The POLR1C polr1c (Catalog #AAA3245294) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The POLR1C Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POLR1C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POLR1C polr1c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGVRNVHTTD FPGNYSGYDD AWDQDRFEKN FRVDVVHMDE NSLEFDMVGI. It is sometimes possible for the material contained within the vial of "POLR1C, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.