MAOA blocking peptide

MAOA Peptide - middle region

Cat. Num. AAA3245136

• Gene Names: MAOA; BRNRS; MAO-A
• Reactivity: Human
• Applications: Western Blot
• Synonyms: MAOA; MAOA Peptide - middle region; MAOA blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: TYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKE
• Sequence Length: 167

• Applicable Applications for MAOA blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for MAOA blocking peptide

This gene is one of two neighboring gene family members that encode mitochondrial enzymes which catalyze the oxidative deamination of amines, such as dopamine, norepinephrine, and serotonin. Mutation of this gene results in Brunner syndrome. This gene has also been associated with a variety of other psychiatric disorders, including antisocial behavior. Alternatively spliced transcript variants encoding multiple isoforms have been observed.

Product Categories/Family for MAOA blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 4557735
• NCBI GeneID: 4128
• NCBI Accession #: NP_000231.1
• NCBI GenBank Nucleotide #: NM_000240.3
• UniProt Accession #: P21397
• Molecular Weight: 60 kDa
• NCBI Official Full Name: amine oxidase
• NCBI Official Synonym Full Names: monoamine oxidase A
• NCBI Official Symbol: MAOA
• NCBI Official Synonym Symbols: BRNRS; MAO-A
• NCBI Protein Information: amine oxidase [flavin-containing] A
• UniProt Protein Name: Amine oxidase [flavin-containing] A
• Protein Family: Amine oxidase
• UniProt Gene Name: MAOA
• UniProt Synonym Gene Names: MAO-A
• UniProt Entry Name: AOFA_HUMAN

NCBI Description

This gene is one of two neighboring gene family members that encode mitochondrial enzymes which catalyze the oxidative deamination of amines, such as dopamine, norepinephrine, and serotonin. Mutation of this gene results in Brunner syndrome. This gene has also been associated with a variety of other psychiatric disorders, including antisocial behavior. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012]

Uniprot Description

MAOA: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine. Defects in MAOA are the cause of Brunner syndrome (BRUNS). Brunner syndrome is a form of X-linked non- dysmorphic mild mental retardation. Male patients are affected by a syndrome of borderline mental retardation and exhibit abnormal behavior, including disturbed regulation of impulsive aggression. Obligate female carriers have normal intelligence and behavior. Belongs to the flavin monoamine oxidase family.

Protein type: EC 1.4.3.4; Membrane protein, integral; Amino Acid Metabolism - tryptophan; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Amino Acid Metabolism - histidine; Amino Acid Metabolism - arginine and proline; Amino Acid Metabolism - phenylalanine; Amino Acid Metabolism - glycine, serine and threonine; Oxidoreductase; Amino Acid Metabolism - tyrosine

Chromosomal Location of Human Ortholog: Xp11.3

Cellular Component: mitochondrial outer membrane; mitochondrion; integral to membrane

Molecular Function: amine oxidase activity

Biological Process: synaptic transmission; biogenic amine metabolic process; neurotransmitter catabolic process; dopamine catabolic process; xenobiotic metabolic process; neurotransmitter secretion; neurotransmitter biosynthetic process

Disease: Brunner Syndrome