Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FCGR2A blocking peptide

FCGR2A Peptide - middle region

Gene Names
FCGR2A; CD32; FCG2; FcGR; CD32A; CDw32; FCGR2; IGFR2; FCGR2A1
Reactivity
Human
Applications
Western Blot
Synonyms
FCGR2A; FCGR2A Peptide - middle region; FCGR2A blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: EFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSH
Sequence Length
317
Applicable Applications for FCGR2A blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FCGR2A blocking peptide
This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.
Product Categories/Family for FCGR2A blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
low affinity immunoglobulin gamma Fc region receptor II-a isoform 1
NCBI Official Synonym Full Names
Fc fragment of IgG receptor IIa
NCBI Official Symbol
FCGR2A
NCBI Official Synonym Symbols
CD32; FCG2; FcGR; CD32A; CDw32; FCGR2; IGFR2; FCGR2A1
NCBI Protein Information
low affinity immunoglobulin gamma Fc region receptor II-a
UniProt Protein Name
Low affinity immunoglobulin gamma Fc region receptor II-a
UniProt Gene Name
FCGR2A
UniProt Synonym Gene Names
CD32; FCG2; FCGR2A1; IGFR2; IgG Fc receptor II-a; Fc-gamma-RIIa; FcRII-a
UniProt Entry Name
FCG2A_HUMAN

NCBI Description

This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2008]

Uniprot Description

FCGR2A: low affinity receptor for the Fc region of IgGs. Binding to IgG initiates cellular responses against pathogens and soluble antigens. A type I membrane protein found on monocytes, neutrophils and platelets. SHP-1 associates with this protein to modulate signaling events in myeloid cells.

Protein type: Cell surface; Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: plasma membrane; integral to membrane

Molecular Function: IgG binding

Biological Process: innate immune response

Disease: Systemic Lupus Erythematosus; Malaria, Susceptibility To

Research Articles on FCGR2A

Similar Products

Product Notes

The FCGR2A fcgr2a (Catalog #AAA3245085) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FCGR2A Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FCGR2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FCGR2A fcgr2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EFQEGETIML RCHSWKDKPL VKVTFFQNGK SQKFSHLDPT FSIPQANHSH. It is sometimes possible for the material contained within the vial of "FCGR2A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.