Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FOXO4Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human FOXO4 Polyclonal Antibody | anti-FOXO4 antibody

FOXO4 Antibody - middle region

Gene Names
FOXO4; AFX; AFX1; MLLT7
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FOXO4; Polyclonal Antibody; FOXO4 Antibody - middle region; anti-FOXO4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHS
Sequence Length
505
Applicable Applications for anti-FOXO4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human FOXO4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FOXO4Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FOXO4Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-FOXO4 antibody
This gene encodes a member of the O class of winged helix/forkhead transcription factor family. Proteins encoded by this class are regulated by factors involved in growth and differentiation indicating they play a role in these processes. A translocation involving this gene on chromosome X and the homolog of the Drosophila trithorax gene, encoding a DNA binding protein, located on chromosome 11 is associated with leukemia. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
forkhead box protein O4 isoform 2
NCBI Official Synonym Full Names
forkhead box O4
NCBI Official Symbol
FOXO4
NCBI Official Synonym Symbols
AFX; AFX1; MLLT7
NCBI Protein Information
forkhead box protein O4
UniProt Protein Name
Forkhead box protein O4
Protein Family
UniProt Gene Name
FOXO4
UniProt Synonym Gene Names
AFX; AFX1; MLLT7
UniProt Entry Name
FOXO4_HUMAN

NCBI Description

This gene encodes a member of the O class of winged helix/forkhead transcription factor family. Proteins encoded by this class are regulated by factors involved in growth and differentiation indicating they play a role in these processes. A translocation involving this gene on chromosome X and the homolog of the Drosophila trithorax gene, encoding a DNA binding protein, located on chromosome 11 is associated with leukemia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]

Uniprot Description

FOXO4: transcription factor AFX1 containing 1 fork-head domain. May play a role in the insulin signaling pathway. Involved in acute leukemias by a chromosomal translocation t(X;11)(q13;q23) that involves MLLT7 and MLL/HRX. The result is a rogue activator protein. Two splice-variant isoforms have been described.

Protein type: DNA-binding; Oncoprotein; Transcription factor

Chromosomal Location of Human Ortholog: Xq13.1

Cellular Component: nucleoplasm; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; enzyme binding; DNA binding; sequence-specific DNA binding; transcription factor activity; transcription factor binding

Biological Process: epidermal growth factor receptor signaling pathway; transcription from RNA polymerase II promoter; muscle development; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; positive regulation of transcription, DNA-dependent; stem cell differentiation; negative regulation of smooth muscle cell differentiation; regulation of transcription from RNA polymerase II promoter; negative regulation of cell proliferation; negative regulation of angiogenesis; regulation of transcription, DNA-dependent; mitotic cell cycle G2/M transition DNA damage checkpoint; insulin receptor signaling pathway; innate immune response; cell cycle arrest

Research Articles on FOXO4

Similar Products

Product Notes

The FOXO4 foxo4 (Catalog #AAA3222347) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXO4 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOXO4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FOXO4 foxo4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AIESAPEKRL TLAQIYEWMV RTVPYFKDKG DSNSSAGWKN SIRHNLSLHS. It is sometimes possible for the material contained within the vial of "FOXO4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.