Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

XPNPEP1 blocking peptide

XPNPEP1 Peptide - middle region

Gene Names
XPNPEP1; APP1; SAMP; XPNPEP; XPNPEPL; XPNPEPL1
Reactivity
Human
Synonyms
XPNPEP1; XPNPEP1 Peptide - middle region; XPNPEP1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAA
Sequence Length
666
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for XPNPEP1 blocking peptide
This gene encodes the cytosolic form of a metalloaminopeptidase that catalyzes the cleavage of the N-terminal amino acid adjacent to a proline residue. The gene product may play a role in degradation and maturation of tachykinins, neuropeptides, and peptide hormones. Alternative splicing results in multiple transcript variants.
Product Categories/Family for XPNPEP1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
xaa-Pro aminopeptidase 1 isoform 1
NCBI Official Synonym Full Names
X-prolyl aminopeptidase 1
NCBI Official Symbol
XPNPEP1
NCBI Official Synonym Symbols
APP1; SAMP; XPNPEP; XPNPEPL; XPNPEPL1
NCBI Protein Information
xaa-Pro aminopeptidase 1
UniProt Protein Name
Xaa-Pro aminopeptidase 1
UniProt Gene Name
XPNPEP1
UniProt Synonym Gene Names
sAmp
UniProt Entry Name
XPP1_HUMAN

NCBI Description

This gene encodes the cytosolic form of a metalloaminopeptidase that catalyzes the cleavage of the N-terminal amino acid adjacent to a proline residue. The gene product may play a role in degradation and maturation of tachykinins, neuropeptides, and peptide hormones. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Nov 2009]

Uniprot Description

XPNPEP1: Contributes to the degradation of bradykinin. Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro. Belongs to the peptidase M24B family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.11.9; Protease

Chromosomal Location of Human Ortholog: 10q25.3

Cellular Component: cytoplasm

Molecular Function: aminopeptidase activity; manganese ion binding; protein homodimerization activity

Biological Process: proteolysis

Research Articles on XPNPEP1

Similar Products

Product Notes

The XPNPEP1 xpnpep1 (Catalog #AAA3244796) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The XPNPEP1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: LDEVYLIDSG AQYKDGTTDV TRTMHFGTPT AYEKECFTYV LKGHIAVSAA. It is sometimes possible for the material contained within the vial of "XPNPEP1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.