Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SNRPB blocking peptide

SNRPB Peptide - middle region

Gene Names
SNRPB; COD; CCMS; SNRPB1; SmB/B'; Sm-B/B'; snRNP-B; SmB/SmB'
Reactivity
Human
Applications
Western Blot
Synonyms
SNRPB; SNRPB Peptide - middle region; SNRPB blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: IKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGA
Sequence Length
289
Applicable Applications for SNRPB blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SNRPB blocking peptide
The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene.
Product Categories/Family for SNRPB blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
small nuclear ribonucleoprotein-associated proteins B and B' isoform B
NCBI Official Synonym Full Names
small nuclear ribonucleoprotein polypeptides B and B1
NCBI Official Symbol
SNRPB
NCBI Official Synonym Symbols
COD; CCMS; SNRPB1; SmB/B'; Sm-B/B'; snRNP-B; SmB/SmB'
NCBI Protein Information
small nuclear ribonucleoprotein-associated proteins B and B'
UniProt Protein Name
Small nuclear ribonucleoprotein-associated proteins B and B'
UniProt Gene Name
SNRPB
UniProt Synonym Gene Names
COD; SNRPB1; snRNP-B; Sm-B/B'; SmB/B'
UniProt Entry Name
RSMB_HUMAN

NCBI Description

The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

snRNP B1: Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5. May have a functional role in the pre-mRNA splicing or in snRNP structure. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner. Belongs to the snRNP SmB/SmN family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA splicing; Spliceosome; RNA-binding; RNA processing

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: small nuclear ribonucleoprotein complex; nucleoplasm; spliceosome; snRNP U1; cytosol; U12-dependent spliceosome

Molecular Function: protein binding

Biological Process: transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; spliceosomal snRNP biogenesis; RNA splicing; histone mRNA metabolic process; gene expression; mRNA 3'-end processing; termination of RNA polymerase II transcription

Research Articles on SNRPB

Similar Products

Product Notes

The SNRPB snrpb (Catalog #AAA3244473) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SNRPB Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNRPB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNRPB snrpb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IKPKNSKQAE REEKRVLGLV LLRGENLVSM TVEGPPPKDT GIARVPLAGA. It is sometimes possible for the material contained within the vial of "SNRPB, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.