Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Syt17 blocking peptide

Syt17 Peptide - N-terminal region

Gene Names
Syt17; Bk; sytXVII
Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Syt17; Syt17 Peptide - N-terminal region; Syt17 blocking peptide
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: AQTPPWLMASRSNDKDGDSVHTASDVPLTPRTNSPDGRRSSSDTSKSTYS
Sequence Length
470
Applicable Applications for Syt17 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Syt17 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Syt17 Antibody, made

Target Description: The function of this protein remains unknown.
Product Categories/Family for Syt17 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
synaptotagmin-17 isoform 1
NCBI Official Synonym Full Names
synaptotagmin XVII
NCBI Official Symbol
Syt17
NCBI Official Synonym Symbols
Bk; sytXVII
NCBI Protein Information
synaptotagmin-17
UniProt Protein Name
Synaptotagmin-17
Protein Family
UniProt Gene Name
Syt17
UniProt Synonym Gene Names
Bk; SytXVII
UniProt Entry Name
SYT17_MOUSE

Research Articles on Syt17

1. The N-terminal domain of B/K protein contains a novel cysteine-based motif that allows B/K protein to localize in the trans-Golgi network.

Similar Products

SYT17 Antibody

Host: Rabbit
Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Apps: Western Blot

SYT17 Antibody

Host: Rabbit
Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Apps: Western Blot

Product Notes

The Syt17 syt17 (Catalog #AAA3242794) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Syt17 Peptide - N-terminal region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Syt17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Syt17 syt17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AQTPPWLMAS RSNDKDGDSV HTASDVPLTP RTNSPDGRRS SSDTSKSTYS. It is sometimes possible for the material contained within the vial of "Syt17, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

aaabiotech.com © 2012-2025

All rights reserved.

Contact us by

Tel: +1 (619) 604-9440 | Fax: +1 (619) 604-9440
contact@aaabiotech.com
Looking for a specific manual?
Request a Manual