Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CCDC99 blocking peptide

CCDC99 Peptide - C-terminal region

Gene Names
SPDL1; CCDC99
Reactivity
Human
Applications
Western Blot
Synonyms
CCDC99; CCDC99 Peptide - C-terminal region; CCDC99 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
PRLAAESKLQTEVKEGKETSSKLEKETCKKLHPILYVSSKSTPETQCPQQ
Sequence Length
605
Applicable Applications for CCDC99 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CCDC99 blocking peptide
CCDC99 is required for the localization of dynein and dynactin to the mitotic kintochore. Dynein is believed to control the initial lateral interaction between the kinetochore and spindle microtubules and to facilitate the subsequent formation of end-on kinetochore-microtubule attachments mediated by the NDC80 complex. CCDC99 is also required for correct spindle orientation. It does not appear to be required for the removal of spindle assembly checkpoint (SAC) proteins from the kinetochore upon bipolar spindle attachment.
Product Categories/Family for CCDC99 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
protein Spindly isoform b
NCBI Official Synonym Full Names
spindle apparatus coiled-coil protein 1
NCBI Official Symbol
SPDL1
NCBI Official Synonym Symbols
CCDC99
NCBI Protein Information
protein Spindly
UniProt Protein Name
Protein Spindly
UniProt Gene Name
SPDL1
UniProt Synonym Gene Names
CCDC99; hSpindly
UniProt Entry Name
SPDLY_HUMAN

NCBI Description

This gene encodes a coiled-coil domain-containing protein that functions in mitotic spindle formation and chromosome segregation. The encoded protein plays a role in coordinating microtubule attachment by promoting recruitment of dynein proteins, and in mitotic checkpoint signaling. [provided by RefSeq, Jul 2016]

Uniprot Description

CCDC99: Required for the localization of dynein and dynactin to the mitotic kintochore. Dynein is believed to control the initial lateral interaction between the kinetochore and spindle microtubules and to facilitate the subsequent formation of end-on kinetochore-microtubule attachments mediated by the NDC80 complex. Also required for correct spindle orientation. Does not appear to be required for the removal of spindle assembly checkpoint (SAC) proteins from the kinetochore upon bipolar spindle attachment. Belongs to the Spindly family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 5q35.1

Cellular Component: spindle pole; microtubule organizing center; outer kinetochore of condensed chromosome; cytosol; nucleus

Molecular Function: kinetochore binding; protein binding; enzyme binding

Biological Process: establishment of mitotic spindle orientation; spindle checkpoint; cell division; mitotic cell cycle; mitotic metaphase plate congression

Research Articles on CCDC99

Similar Products

Product Notes

The CCDC99 spdl1 (Catalog #AAA3242373) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CCDC99 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCDC99 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCDC99 spdl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PRLAAESKLQ TEVKEGKETS SKLEKETCKK LHPILYVSSK STPETQCPQQ. It is sometimes possible for the material contained within the vial of "CCDC99, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.