Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Nus1 blocking peptide

Nus1 Peptide - middle region

Gene Names
Nus1; AU019165; AW538011; BC003223; D10Ertd438e; 1600027K07Rik
Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Nus1; Nus1 Peptide - middle region; Nus1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: RLMDEILKQQQELLGQDCSKYSAEFANSNDKDDQDLNCPSAVKVLSPEDG
Sequence Length
297
Applicable Applications for Nus1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Nus1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Nus1 Antibody, made

Target Description: Nus1 acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator. It regulates the stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol.
Product Categories/Family for Nus1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
dehydrodolichyl diphosphate synthase complex subunit Nus1
NCBI Official Synonym Full Names
NUS1 dehydrodolichyl diphosphate synthase subunit
NCBI Official Symbol
Nus1
NCBI Official Synonym Symbols
AU019165; AW538011; BC003223; D10Ertd438e; 1600027K07Rik
NCBI Protein Information
dehydrodolichyl diphosphate synthase complex subunit Nus1
UniProt Protein Name
Nogo-B receptor
UniProt Gene Name
Nus1
UniProt Synonym Gene Names
D10Ertd438e; Ngbr; NgBR
UniProt Entry Name
NGBR_MOUSE

Uniprot Description

Function: Acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator. Regulates the stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol

By similarity.Essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery

By similarity.

Pathway: Protein modification; protein glycosylation.

Subunit structure: Interacts with DHDDS, promoting its isoprenyltransferase activity. Interacts with NPC2

By similarity.

Subcellular location: Endoplasmic reticulum membrane; Single-pass type I membrane protein. Note: Colocalizes with Nogo-B during VEGF and wound healing angiogenesis

By similarity.

Tissue specificity: Highly expressed in heart, liver, kidney and pancreas. Ref.3

Miscellaneous: Although strongly related to UPP synthase family proteins, it has no lipid transferase activity.NUS1 seems to exist in two topological orientations, a minor glycosylated species with its C-terminus oriented towards the lumen regulating NPC2 stability, and a major fraction oriented with its C-terminus directed towards the cytosol where it regulates cis-IPTase activity

By similarity.

Sequence similarities: Belongs to the UPP synthase family.

Sequence caution: The sequence AAH18372.1 differs from that shown. Reason: Frameshift at position 10. The sequence BAE33349.1 differs from that shown. Reason: Frameshift at position 252.

Research Articles on Nus1

Similar Products

Product Notes

The Nus1 nus1 (Catalog #AAA3242173) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Nus1 Peptide - middle region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Nus1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Nus1 nus1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLMDEILKQQ QELLGQDCSK YSAEFANSND KDDQDLNCPS AVKVLSPEDG. It is sometimes possible for the material contained within the vial of "Nus1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.