Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DYNLRB1 blocking peptide

DYNLRB1 Peptide - N-terminal region

Gene Names
DYNLRB1; BLP; BITH; DNCL2A; DNLC2A; ROBLD1
Reactivity
Human
Applications
Western Blot
Synonyms
DYNLRB1; DYNLRB1 Peptide - N-terminal region; DYNLRB1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
VNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIR
Sequence Length
96
Applicable Applications for DYNLRB1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DYNLRB1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-DYNLRB1 Antibody, made

Target Description: This gene is a member of the roadblock dynein light chain family and encodes a cytoplasmic protein that is capable of binding intermediate chain proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression.
Product Categories/Family for DYNLRB1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
dynein light chain roadblock-type 1 isoform a
NCBI Official Synonym Full Names
dynein light chain roadblock-type 1
NCBI Official Symbol
DYNLRB1
NCBI Official Synonym Symbols
BLP; BITH; DNCL2A; DNLC2A; ROBLD1
NCBI Protein Information
dynein light chain roadblock-type 1
UniProt Protein Name
Dynein light chain roadblock-type 1
Protein Family
UniProt Gene Name
DYNLRB1
UniProt Synonym Gene Names
BITH; DNCL2A; DNLC2A; ROBLD1; BLP
UniProt Entry Name
DLRB1_HUMAN

NCBI Description

This gene is a member of the roadblock dynein light chain family. The encoded cytoplasmic protein is capable of binding intermediate chain proteins, interacts with transforming growth factor-beta, and has been implicated in the regulation of actin modulating proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 12 and 18. [provided by RefSeq, Aug 2013]

Uniprot Description

DYNLRB1: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Belongs to the GAMAD family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 20q11.21

Cellular Component: microtubule; centrosome; membrane; cytoplasmic dynein complex; cytoplasm

Molecular Function: microtubule motor activity

Biological Process: metabolic process; transport; organelle organization and biogenesis; microtubule-based movement; visual behavior

Research Articles on DYNLRB1

Similar Products

Product Notes

The DYNLRB1 dynlrb1 (Catalog #AAA3241720) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DYNLRB1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DYNLRB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DYNLRB1 dynlrb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VNTEGIPIKS TMDNPTTTQY ASLMHSFILK ARSTVRDIDP QNDLTFLRIR. It is sometimes possible for the material contained within the vial of "DYNLRB1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.