Dynein light chain roadblock-type 1 Recombinant Protein | DYNLRB1 recombinant protein

Recombinant Human Dynein light chain roadblock-type 1

Cat. Num. AAA1335082

• Gene Names: DYNLRB1; BLP; BITH; DNCL2A; DNLC2A; ROBLD1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Dynein light chain roadblock-type 1; Recombinant Human Dynein light chain roadblock-type 1; Bithoraxoid-like protein; BLP; Dynein light chain 2A; cytoplasmic; Dynein-associated protein Km23; Roadblock domain-containing protein 1; DYNLRB1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 3-96aa; Partial
• Sequence: EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
• Sequence Length: 63

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for DYNLRB1 recombinant protein

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.

Product Categories/Family for DYNLRB1 recombinant protein

Cancer

References

Identification of two novel human dynein light chain genes, DNLC2A and DNLC2B, and their expression changes in hepatocellular carcinoma tissues from 68 Chinese patients.Jiang J., Yu L., Huang X., Chen X., Li D., Zhang Y., Tang L., Zhao S.Gene 281:103-113(2001) Novel genes expressed in hematopoietic stem/progenitor cells from myelodysplastic syndrome patients.Gu J., Huang Q., Yu Y., Xu S., Han Z., Fu G., Zhou J., Wang Y., Huang C., Ren S., Tu Y., Chen Z. BitH, a human homolog of bithorax Drosophila melanogaster gene, on chromosome 20q.Fracchiolla N.S., Cortelezzi A., Lambertenghi-Deliliers G.Km23 role in growth factor signaling.Tang Q., Staub C.M., Mulder K.M. Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X., Gu J., Chen S.-J., Chen Z.Genome Res. 10:1546-1560(2000) The DNA sequence and comparative analysis of human chromosome 20.Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.Nature 414:865-871(2001) Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J.Nat. Biotechnol. 21:566-569(2003) Lubec G., Chen W.-Q., Sun Y.Submitted (DEC-2008) to UniProtKB The roadblock light chain binds a novel region of the cytoplasmic Dynein intermediate chain.Susalka S.J., Nikulina K., Salata M.W., Vaughan P.S., King S.M., Vaughan K.T., Pfister K.K.J. Biol. Chem. 277:32939-32946(2002) Rab6 family proteins interact with the dynein light chain protein DYNLRB1.Wanschers B.F.J., van de Vorstenbosch R., Wijers M., Wieringa B., King S.M., Fransen J.Cell Motil. Cytoskeleton 65:183-196(2008) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Structure and dynamics of the homodimeric dynein light chain km23.Ilangovan U., Ding W., Zhong Y., Wilson C.L., Groppe J.C., Trbovich J.T., Zuniga J., Demeler B., Tang Q., Gao G., Mulder K.M., Hinck A.P.J. Mol. Biol. 352:338-354(2005) Crystal structure of human dynein light chain Dnlc2A structural insights into the interaction with IC74.Liu J.F., Wang Z.X., Wang X.Q., Tang Q., An X.M., Gui L.L., Liang D.C.Biochem. Biophys. Res. Commun. 349:1125-1129(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 528524492
• NCBI GeneID: 83658
• NCBI Accession #: NP_001268656.1
• NCBI GenBank Nucleotide #: NM_001281727.1
• UniProt Accession #: Q9NP97; Q5TC72; Q96IV3; Q9NQM2; B1AKR5
• Molecular Weight: 26.7 kDa
• NCBI Official Full Name: dynein light chain roadblock-type 1 isoform b
• NCBI Official Synonym Full Names: dynein, light chain, roadblock-type 1
• NCBI Official Symbol: DYNLRB1
• NCBI Official Synonym Symbols: BLP; BITH; DNCL2A; DNLC2A; ROBLD1
• NCBI Protein Information: dynein light chain roadblock-type 1
• UniProt Protein Name: Dynein light chain roadblock-type 1
• Protein Family: Dynein
• UniProt Gene Name: DYNLRB1
• UniProt Synonym Gene Names: BITH; DNCL2A; DNLC2A; ROBLD1; BLP
• UniProt Entry Name: DLRB1_HUMAN

NCBI Description

This gene is a member of the roadblock dynein light chain family. The encoded cytoplasmic protein is capable of binding intermediate chain proteins, interacts with transforming growth factor-beta, and has been implicated in the regulation of actin modulating proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 12 and 18. [provided by RefSeq, Aug 2013]

Uniprot Description

DYNLRB1: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Belongs to the GAMAD family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 20q11.21

Cellular Component: centrosome; cytoplasm; cytoplasmic dynein complex; membrane; microtubule

Molecular Function: microtubule motor activity; protein binding

Biological Process: metabolic process; microtubule-based movement; organelle organization and biogenesis; transport; visual behavior