Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RXFP4 blocking peptide

RXFP4 Peptide - C-terminal region

Gene Names
RXFP4; GPR100; RLN3R2; RXFPR4; GPCR142
Reactivity
Human
Applications
Western Blot
Synonyms
RXFP4; RXFP4 Peptide - C-terminal region; RXFP4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
RDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG
Sequence Length
374
Applicable Applications for RXFP4 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RXFP4 blocking peptide
This is a synthetic peptide designed for use in combination with anti-RXFP4 Antibody, made

Target Description: GPR100 is a member of the rhodopsin family of G protein-coupled receptors (GPRs).
Product Categories/Family for RXFP4 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
relaxin-3 receptor 2
NCBI Official Synonym Full Names
relaxin family peptide/INSL5 receptor 4
NCBI Official Symbol
RXFP4
NCBI Official Synonym Symbols
GPR100; RLN3R2; RXFPR4; GPCR142
NCBI Protein Information
relaxin-3 receptor 2
UniProt Protein Name
Relaxin-3 receptor 2
Protein Family
UniProt Gene Name
RXFP4
UniProt Synonym Gene Names
GPR100; RLN3R2; RLN3 receptor 2
UniProt Entry Name
RL3R2_HUMAN

NCBI Description

GPR100 is a member of the rhodopsin family of G protein-coupled receptors (GPRs) (Fredriksson et al., 2003 [PubMed 14623098]).[supplied by OMIM, Mar 2008]

Uniprot Description

RXFP4: High affinity receptor for INSL5. Also acts as receptor for RLN3/relaxin-3, as well as bradykinin and kallidin. Binding of the ligand inhibit cAMP accumulation. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: integral to membrane; plasma membrane

Molecular Function: protein binding; angiotensin type II receptor activity

Research Articles on RXFP4

Similar Products

Product Notes

The RXFP4 rxfp4 (Catalog #AAA3241475) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RXFP4 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RXFP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RXFP4 rxfp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RDLRLRLWPQ GGGWVQQVAL KQVGRRWVAS NPRESRPSTL LTNLDRGTPG. It is sometimes possible for the material contained within the vial of "RXFP4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.