Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SPARC blocking peptide

SPARC Peptide - C-terminal region

Gene Names
SPARC; ON; OI17; BM-40
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Synonyms
SPARC; SPARC Peptide - C-terminal region; SPARC blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL
Sequence Length
303
Applicable Applications for SPARC blocking peptide
Immunohistochemistry (IHC), Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SPARC blocking peptide
This is a synthetic peptide designed for use in combination with anti-SPARC Antibody, made

Target Description: Secreted protein acidic and rich in cysteine/osteonectin/BM40, or SPARC, is a matrix-associated protein that elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (ECM).
Product Categories/Family for SPARC blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
SPARC isoform 1
NCBI Official Synonym Full Names
secreted protein acidic and cysteine rich
NCBI Official Symbol
SPARC
NCBI Official Synonym Symbols
ON; OI17; BM-40
NCBI Protein Information
SPARC
UniProt Protein Name
SPARC
Protein Family
UniProt Gene Name
SPARC
UniProt Synonym Gene Names
ON; BM-40; ON
UniProt Entry Name
SPRC_HUMAN

NCBI Description

This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2015]

Uniprot Description

SPARC: Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity. Belongs to the SPARC family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5q31.3-q32

Cellular Component: extracellular space; platelet alpha granule membrane; nuclear matrix; cell surface; mitochondrion; cytoplasm; plasma membrane; extracellular region; basement membrane

Molecular Function: collagen binding; protein binding; extracellular matrix binding; calcium ion binding

Biological Process: response to peptide hormone stimulus; receptor-mediated endocytosis; response to gravity; platelet activation; extracellular matrix organization and biogenesis; ossification; response to cAMP; heart development; response to glucocorticoid stimulus; response to lipopolysaccharide; signal transduction; response to L-ascorbic acid; negative regulation of angiogenesis; platelet degranulation; response to cadmium ion; response to ethanol; response to cytokine stimulus; response to lead ion; negative regulation of endothelial cell proliferation; regulation of cell morphogenesis; response to calcium ion; blood coagulation; inner ear development; lung development

Disease: Osteogenesis Imperfecta, Type Xvii

Research Articles on SPARC

Similar Products

Product Notes

The SPARC sparc (Catalog #AAA3240811) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SPARC Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPARC can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SPARC sparc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LAPLRAPLIP MEHCTTRFFE TCDLDNDKYI ALDEWAGCFG IKQKDIDKDL. It is sometimes possible for the material contained within the vial of "SPARC, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.