Western Blot (WB)
(WB Suggested Anti-MSL1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellMSL1 is supported by BioGPS gene expression data to be expressed in 721_B)
Rabbit MSL1 Polyclonal Antibody | anti-MSL1 antibody
MSL1 antibody - middle region
Gene Names
MSL1; MSL-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MSL1; Polyclonal Antibody; MSL1 antibody - middle region; anti-MSL1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEIEDLPYLSTTE
Sequence Length
351
Applicable Applications for anti-MSL1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MSL1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellMSL1 is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(WB Suggested Anti-MSL1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellMSL1 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-MSL1 antibody
This is a rabbit polyclonal antibody against MSL1. It was validated on Western Blot
Target Description: MSL1 is a component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at 'Lys-16' which is implicated in the formation of higher-order chromatin structure.
Target Description: MSL1 is a component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at 'Lys-16' which is implicated in the formation of higher-order chromatin structure.
Product Categories/Family for anti-MSL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
male-specific lethal 1 homolog isoform 1
NCBI Official Synonym Full Names
MSL complex subunit 1
NCBI Official Symbol
MSL1
NCBI Official Synonym Symbols
MSL-1
NCBI Protein Information
male-specific lethal 1 homolog
UniProt Protein Name
Male-specific lethal 1 homolog
Protein Family
UniProt Gene Name
MSL1
UniProt Synonym Gene Names
MSL1L1; MSL-1; MSL1-like 1
UniProt Entry Name
MSL1_HUMAN
Research Articles on MSL1
Similar Products
Product Notes
The MSL1 msl1 (Catalog #AAA3216403) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MSL1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MSL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MSL1 msl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRSQETPEKP RSSVDTPPRL STPQKGPSTH PKEKAFSSEI EDLPYLSTTE. It is sometimes possible for the material contained within the vial of "MSL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
