Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HBE antibody Titration: 1 ug/mLSample Type: Human Stomach Tumor)

Rabbit anti-Human HBE1 Polyclonal Antibody | anti-HBE1 antibody

HBE1 Antibody - N-terminal region

Gene Names
HBE1; HBE
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HBE1; Polyclonal Antibody; HBE1 Antibody - N-terminal region; anti-HBE1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPK
Sequence Length
147
Applicable Applications for anti-HBE1 antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-HBE1 antibody is: synthetic peptide directed towards the N-terminal region of Human HBE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HBE antibody Titration: 1 ug/mLSample Type: Human Stomach Tumor)

Western Blot (WB) (WB Suggested Anti-HBE antibody Titration: 1 ug/mLSample Type: Human Stomach Tumor)
Related Product Information for anti-HBE1 antibody
This is a rabbit polyclonal antibody against HBE. It was validated on Western Blot

Target Description: The epsilon globin gene (HBE) is normally expressed in the embryonic yolk sac: two epsilon chains together with two zeta chains (an alpha-like globin) constitute the embryonic hemoglobin Hb Gower I; two epsilon chains together with two alpha chains form the embryonic Hb Gower II. Both of these embryonic hemoglobins are normally supplanted by fetal, and later, adult hemoglobin. The five beta-like globin genes are found within a 45 kb cluster on chromosome 11 in the following order: 5'-epsilon - G-gamma - A-gamma - delta - beta-3'
Product Categories/Family for anti-HBE1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16 kDa
NCBI Official Full Name
hemoglobin subunit epsilon
NCBI Official Synonym Full Names
hemoglobin subunit epsilon 1
NCBI Official Symbol
HBE1
NCBI Official Synonym Symbols
HBE
NCBI Protein Information
hemoglobin subunit epsilon
UniProt Protein Name
Hemoglobin subunit epsilon
Protein Family
UniProt Gene Name
HBE1
UniProt Synonym Gene Names
HBE
UniProt Entry Name
HBE_HUMAN

NCBI Description

The epsilon globin gene (HBE) is normally expressed in the embryonic yolk sac: two epsilon chains together with two zeta chains (an alpha-like globin) constitute the embryonic hemoglobin Hb Gower I; two epsilon chains together with two alpha chains form the embryonic Hb Gower II. Both of these embryonic hemoglobins are normally supplanted by fetal, and later, adult hemoglobin. The five beta-like globin genes are found within a 45 kb cluster on chromosome 11 in the following order: 5'-epsilon - G-gamma - A-gamma - delta - beta-3' [provided by RefSeq, Jul 2008]

Uniprot Description

HBE1: The epsilon chain is a beta-type chain of early mammalian embryonic hemoglobin. Belongs to the globin family.

Protein type: Carrier

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: hemoglobin complex; cytosol

Molecular Function: iron ion binding; heme binding; hemoglobin alpha binding; oxygen binding; oxygen transporter activity

Biological Process: oxygen transport; protein heterooligomerization; negative regulation of transcription from RNA polymerase II promoter; blood coagulation

Research Articles on HBE1

Similar Products

Product Notes

The HBE1 hbe1 (Catalog #AAA3220291) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HBE1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HBE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HBE1 hbe1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVTSLWSKMN VEEAGGEALG RLLVVYPWTQ RFFDSFGNLS SPSAILGNPK. It is sometimes possible for the material contained within the vial of "HBE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.