Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

LPGAT1 blocking peptide

LPGAT1 Peptide - middle region

Gene Names
LPGAT1; NET8; FAM34A; FAM34A1
Reactivity
Human
Applications
Western Blot
Synonyms
LPGAT1; LPGAT1 Peptide - middle region; LPGAT1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DQQLLLLKKHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAFAKKNNLPF
Sequence Length
370
Applicable Applications for LPGAT1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for LPGAT1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-LPGAT1 Antibody, made

Target Description: LPGAT1 is a lysophoshatidylglycerol (LPG) specific acyltransferase that recognizes various acyl-CoAs and LPGs as substrates but demonstrates a clear preference for long chain saturated fatty acyl-CoAs and oleoyl-CoA as acyl donors. It prefers oleoyl-LPG over palmitoyl-LPG as an acyl receptor and oleoyl-CoA over lauroyl-CoA as an acyl donor.
Product Categories/Family for LPGAT1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Synonym Full Names
lysophosphatidylglycerol acyltransferase 1
NCBI Official Symbol
LPGAT1
NCBI Official Synonym Symbols
NET8; FAM34A; FAM34A1
NCBI Protein Information
acyl-CoA:lysophosphatidylglycerol acyltransferase 1
UniProt Protein Name
Acyl-CoA:lysophosphatidylglycerol acyltransferase 1
UniProt Gene Name
LPGAT1
UniProt Synonym Gene Names
FAM34A; KIAA0205
UniProt Entry Name
LGAT1_HUMAN

NCBI Description

This gene encodes a member of the lysophospholipid acyltransferase family. The encoded protein catalyzes the reacylation of lysophosphatidylglycerol to phosphatidylglycerol, a membrane phospholipid that is an important precursor for the synthesis of cardiolipin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Uniprot Description

LPGAT1: Lysophoshatidylglycerol (LPG) specific acyltransferase that recognizes various acyl-CoAs and LPGs as substrates but demonstrates a clear preference for long chain saturated fatty acyl-CoAs and oleoyl-CoA as acyl donors. Prefers oleoyl-LPG over palmitoyl-LPG as an acyl receptor and oleoyl-CoA over lauroyl-CoA as an acyl donor. Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.

Protein type: Membrane protein, integral; Transferase; EC 2.3.1.-; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: endoplasmic reticulum membrane; membrane; cytoplasm; integral to membrane

Molecular Function: transferase activity, transferring acyl groups

Biological Process: phospholipid metabolic process; glycerophospholipid biosynthetic process

Research Articles on LPGAT1

Similar Products

Product Notes

The LPGAT1 lpgat1 (Catalog #AAA3240539) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The LPGAT1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LPGAT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LPGAT1 lpgat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DQQLLLLKKH LENNYRSRDR KWIVLFPEGG FLRKRRETSQ AFAKKNNLPF. It is sometimes possible for the material contained within the vial of "LPGAT1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.