Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FIS1 blocking peptide

FIS1 Peptide - C-terminal region

Gene Names
FIS1; TTC11; CGI-135
Reactivity
Human
Synonyms
FIS1; FIS1 Peptide - C-terminal region; FIS1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVG
Sequence Length
152
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FIS1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- FIS1 Antibody, made

Target Description: The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrialcomplex that promotes mitochondrial fission.
Product Categories/Family for FIS1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16 kDa
NCBI Official Full Name
mitochondrial fission 1 protein
NCBI Official Synonym Full Names
fission, mitochondrial 1
NCBI Official Symbol
FIS1
NCBI Official Synonym Symbols
TTC11; CGI-135
NCBI Protein Information
mitochondrial fission 1 protein
UniProt Protein Name
Mitochondrial fission 1 protein
UniProt Gene Name
FIS1
UniProt Synonym Gene Names
TTC11; hFis1; TPR repeat protein 11
UniProt Entry Name
FIS1_HUMAN

NCBI Description

The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM, Mar 2008]

Uniprot Description

FIS1: Promotes the fragmentation of the mitochondrial network and its perinuclear clustering. Can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis. Also mediates peroxisomal fission. Belongs to the FIS1 family.

Protein type: Membrane protein, integral; Mitochondrial

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: integral to peroxisomal membrane; protein complex; mitochondrion; membrane; peroxisome; integral to mitochondrial outer membrane

Molecular Function: protein binding; receptor binding

Biological Process: peroxisome fission; mitochondrial fission; release of cytochrome c from mitochondria; elevation of cytosolic calcium ion concentration; mitochondrial fusion; reduction of endoplasmic reticulum calcium ion concentration; mitochondrion degradation; positive regulation of caspase activity; mitochondrial fragmentation during apoptosis; protein targeting to mitochondrion; protein homooligomerization; elevation of mitochondrial calcium ion concentration

Research Articles on FIS1

Similar Products

Product Notes

The FIS1 fis1 (Catalog #AAA3240484) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FIS1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: NYRLKEYEKA LKYVRGLLQT EPQNNQAKEL ERLIDKAMKK DGLVGMAIVG. It is sometimes possible for the material contained within the vial of "FIS1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.