Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FIS1Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human FIS1 Polyclonal Antibody | anti-FIS1 antibody

FIS1 Antibody - C-terminal region

Gene Names
FIS1; TTC11; CGI-135
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
FIS1; Polyclonal Antibody; FIS1 Antibody - C-terminal region; anti-FIS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVG
Sequence Length
152
Applicable Applications for anti-FIS1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FIS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FIS1Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FIS1Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-FIS1 antibody
fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)

Target Description: The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrialcomplex that promotes mitochondrial fission.
Product Categories/Family for anti-FIS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16 kDa
NCBI Official Full Name
mitochondrial fission 1 protein
NCBI Official Synonym Full Names
fission, mitochondrial 1
NCBI Official Symbol
FIS1
NCBI Official Synonym Symbols
TTC11; CGI-135
NCBI Protein Information
mitochondrial fission 1 protein
UniProt Protein Name
Mitochondrial fission 1 protein
UniProt Gene Name
FIS1
UniProt Synonym Gene Names
TTC11; hFis1; TPR repeat protein 11
UniProt Entry Name
FIS1_HUMAN

NCBI Description

The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM, Mar 2008]

Uniprot Description

FIS1: Promotes the fragmentation of the mitochondrial network and its perinuclear clustering. Can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis. Also mediates peroxisomal fission. Belongs to the FIS1 family.

Protein type: Membrane protein, integral; Mitochondrial

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: integral to peroxisomal membrane; protein complex; mitochondrion; membrane; peroxisome; integral to mitochondrial outer membrane

Molecular Function: protein binding; receptor binding

Biological Process: peroxisome fission; mitochondrial fission; release of cytochrome c from mitochondria; elevation of cytosolic calcium ion concentration; mitochondrial fusion; reduction of endoplasmic reticulum calcium ion concentration; mitochondrion degradation; positive regulation of caspase activity; mitochondrial fragmentation during apoptosis; protein targeting to mitochondrion; protein homooligomerization; elevation of mitochondrial calcium ion concentration

Research Articles on FIS1

Similar Products

Product Notes

The FIS1 fis1 (Catalog #AAA3215581) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FIS1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FIS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FIS1 fis1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NYRLKEYEKA LKYVRGLLQT EPQNNQAKEL ERLIDKAMKK DGLVGMAIVG. It is sometimes possible for the material contained within the vial of "FIS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.