RASAL1 blocking peptide

RASAL1 Peptide - C-terminal region

Cat. Num. AAA3240444

• Gene Names: RASAL1; RASAL
• Reactivity: Human
• Applications: Western Blot
• Synonyms: RASAL1; RASAL1 Peptide - C-terminal region; RASAL1 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: DTTLEADTGACPEVLARQRAATARLLEVLADLDRAHEEFQQQERGKAALG
• Sequence Length: 804

• Applicable Applications for RASAL1 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for RASAL1 blocking peptide

This is a synthetic peptide designed for use in combination with anti-RASAL1 Antibody, made

Target Description: The protein encoded by this gene is member of the GAP1 family of GTPase-activating proteins. These proteins stimulate the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. This particular family member contains domains which are characteristic of the GAP1 subfamily of RasGAP proteins but, in contrast to the other GAP1 family members, this protein is strongly and selectively expressed in endocrine tissues. Alternatively spliced transcript variants that encode different isoforms have been described.

Product Categories/Family for RASAL1 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 302058252
• NCBI GeneID: 8437
• NCBI Accession #: NP_004649
• NCBI GenBank Nucleotide #: NM_004658
• UniProt Accession #: O95294
• Molecular Weight: 88kDa
• NCBI Official Full Name: rasGAP-activating-like protein 1 isoform 1
• NCBI Official Synonym Full Names: RAS protein activator like 1
• NCBI Official Symbol: RASAL1
• NCBI Official Synonym Symbols: RASAL
• NCBI Protein Information: rasGAP-activating-like protein 1
• UniProt Protein Name: RasGAP-activating-like protein 1
• Protein Family: RasGAP-activating-like protein
• UniProt Gene Name: RASAL1
• UniProt Synonym Gene Names: RASAL
• UniProt Entry Name: RASL1_HUMAN

NCBI Description

The protein encoded by this gene is member of the GAP1 family of GTPase-activating proteins. These proteins stimulate the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. This particular family member contains domains which are characteristic of the GAP1 subfamily of RasGAP proteins but, in contrast to the other GAP1 family members, this protein is strongly and selectively expressed in endocrine tissues. Alternatively spliced transcript variants that encode different isoforms have been described [provided by RefSeq, Jul 2010]