Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DNAL1 blocking peptide

DNAL1 Peptide - N-terminal region

Gene Names
DNAL1; LC1; CILD16; C14orf168
Reactivity
Human
Applications
Western Blot
Synonyms
DNAL1; DNAL1 Peptide - N-terminal region; DNAL1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
TTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLS
Sequence Length
151
Applicable Applications for DNAL1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DNAL1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-DNAL1 Antibody, made

Target Description: This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. Alternate splicing results in multiple transcript variants.
Product Categories/Family for DNAL1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
dynein light chain 1, axonemal isoform 1
NCBI Official Synonym Full Names
dynein axonemal light chain 1
NCBI Official Symbol
DNAL1
NCBI Official Synonym Symbols
LC1; CILD16; C14orf168
NCBI Protein Information
dynein light chain 1, axonemal
UniProt Protein Name
Dynein light chain 1, axonemal
Protein Family
UniProt Gene Name
DNAL1
UniProt Synonym Gene Names
C14orf168
UniProt Entry Name
DNAL1_HUMAN

NCBI Description

This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jan 2011]

Uniprot Description

DNAL1: Defects in DNAL1 are the cause of primary ciliary dyskinesia type 16 (CILD16). A disorder characterized by abnormalities of motile cilia. Respiratory infections leading to chronic inflammation and bronchiectasis are recurrent, due to defects in the respiratory cilia; reduced fertility is often observed in male patients due to abnormalities of sperm tails. Half of the patients exhibit randomization of left-right body asymmetry and situs inversus, due to dysfunction of monocilia at the embryonic node. Primary ciliary dyskinesia associated with situs inversus is referred to as Kartagener syndrome. Belongs to the dynein light chain LC1-type family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 14q24.3

Disease: Ciliary Dyskinesia, Primary, 16

Research Articles on DNAL1

Similar Products

Product Notes

The DNAL1 dnal1 (Catalog #AAA3240430) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DNAL1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNAL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DNAL1 dnal1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TTIKEALARW EEKTGQRPSE AKEIKLYAQI PPIEKMDASL SMLANCEKLS. It is sometimes possible for the material contained within the vial of "DNAL1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.