Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CD3E blocking peptide

CD3E Peptide - middle region

Gene Names
CD3E; T3E; TCRE; IMD18
Reactivity
Human
Applications
Western Blot
Synonyms
CD3E; CD3E Peptide - middle region; CD3E blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
QYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYP
Sequence Length
207
Applicable Applications for CD3E blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CD3E blocking peptide
This is a synthetic peptide designed for use in combination with anti-CD3E Antibody, made

Target Description: The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
Product Categories/Family for CD3E blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
916
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
T-cell surface glycoprotein CD3 epsilon chain
NCBI Official Synonym Full Names
CD3e molecule
NCBI Official Symbol
CD3E
NCBI Official Synonym Symbols
T3E; TCRE; IMD18
NCBI Protein Information
T-cell surface glycoprotein CD3 epsilon chain
UniProt Protein Name
T-cell surface glycoprotein CD3 epsilon chain
UniProt Gene Name
CD3E
UniProt Synonym Gene Names
T3E
UniProt Entry Name
CD3E_HUMAN

NCBI Description

The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. [provided by RefSeq, Jul 2008]

Uniprot Description

CD3E: a T cell surface glycoprotein that is a component of the T cell antigen receptor. The recruitment of Nck by CD3 epsilon reveals a ligand-induced conformational change essential for T cell receptor signaling and synapse formation. Contains 1 immunoglobulin-like domain and 1 ITAM domain.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: T cell receptor complex; integral to plasma membrane; plasma membrane; immunological synapse; alpha-beta T cell receptor complex; intercellular junction; external side of plasma membrane

Molecular Function: protein binding; transmembrane receptor activity; receptor signaling complex scaffold activity; protein heterodimerization activity; receptor signaling protein activity; T cell receptor binding; SH3 domain binding; protein kinase binding

Biological Process: regulation of immune response; T cell activation; positive regulation of interleukin-2 biosynthetic process; signal complex assembly; positive regulation of calcium-mediated signaling; negative thymic T cell selection; T cell receptor signaling pathway; positive regulation of interleukin-4 production; regulation of apoptosis; G-protein coupled receptor protein signaling pathway; positive regulation of interferon-gamma production; positive regulation of peptidyl-tyrosine phosphorylation; cell surface receptor linked signal transduction; negative regulation of smoothened signaling pathway; T cell costimulation; protein complex assembly; positive regulation of alpha-beta T cell proliferation; positive regulation of T cell proliferation; positive regulation of T cell anergy; transmembrane receptor protein tyrosine kinase signaling pathway; response to nutrient

Disease: Immunodeficiency 18

Research Articles on CD3E

Similar Products

Product Notes

The CD3E cd3e (Catalog #AAA3239119) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CD3E Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD3E can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD3E cd3e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QYPGSEILWQ HNDKNIGGDE DDKNIGSDED HLSLKEFSEL EQSGYYVCYP. It is sometimes possible for the material contained within the vial of "CD3E, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.