Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATG16L1 blocking peptide

ATG16L1 Peptide - middle region

Gene Names
ATG16L1; IBD10; WDR30; APG16L; ATG16A; ATG16L
Reactivity
Human
Applications
Western Blot
Synonyms
ATG16L1; ATG16L1 Peptide - middle region; ATG16L1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
TRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPG
Sequence Length
266
Applicable Applications for ATG16L1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ATG16L1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ATG16L1 Antibody, made

Target Description: Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy.
Product Categories/Family for ATG16L1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
autophagy-related protein 16-1 isoform 4
NCBI Official Synonym Full Names
autophagy related 16 like 1
NCBI Official Symbol
ATG16L1
NCBI Official Synonym Symbols
IBD10; WDR30; APG16L; ATG16A; ATG16L
NCBI Protein Information
autophagy-related protein 16-1
UniProt Protein Name
Autophagy-related protein 16-1
Protein Family
UniProt Gene Name
ATG16L1
UniProt Synonym Gene Names
APG16L
UniProt Entry Name
A16L1_HUMAN

NCBI Description

The protein encoded by this gene is part of a large protein complex that is necessary for autophagy, the major process by which intracellular components are targeted to lysosomes for degradation. Defects in this gene are a cause of susceptibility to inflammatory bowel disease type 10 (IBD10). Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2010]

Uniprot Description

ATG16: Plays an essential role in autophagy. Homooligomer. Interacts with ATG5. Part of either the minor and major complexes respectively composed of 4 sets of ATG12-ATG5 and ATG16L1 (400 kDa) or 8 sets of ATG12-ATG5 and ATG16L1 (800 kDa). Belongs to the WD repeat ATG16 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, peripheral; Adaptor/scaffold; Autophagy

Chromosomal Location of Human Ortholog: 2q37.1

Cellular Component: pre-autophagosomal structure membrane; autophagic vacuole; axoneme

Molecular Function: identical protein binding; protein binding

Biological Process: protein transport; protein homooligomerization; autophagic vacuole formation

Disease: Inflammatory Bowel Disease 10

Research Articles on ATG16L1

Similar Products

Product Notes

The ATG16L1 atg16l1 (Catalog #AAA3239052) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ATG16L1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATG16L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATG16L1 atg16l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TRRSVSSFPV PQDNVDTHPG SGKEVRVPAT ALCVFDAHDG EVNAVQFSPG. It is sometimes possible for the material contained within the vial of "ATG16L1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.