Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Liver)

Rabbit ATG16L1 Polyclonal Antibody | anti-ATG16L1 antibody

ATG16L1 antibody - N-terminal region

Gene Names
ATG16L1; IBD10; WDR30; APG16L; ATG16A; ATG16L
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ATG16L1; Polyclonal Antibody; ATG16L1 antibody - N-terminal region; anti-ATG16L1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQ
Sequence Length
588
Applicable Applications for anti-ATG16L1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 91%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ATG16L1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Liver)

Immunohistochemistry (IHC) (Liver)

Western Blot (WB)

(Host: RabbitTarget Name: ATG16L1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ATG16L1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-ATG16L1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-ATG16L1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Related Product Information for anti-ATG16L1 antibody
This is a rabbit polyclonal antibody against ATG16L1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy.Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy (Mizushima et al., 2003 [PubMed 12665549]).[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
autophagy-related protein 16-1 isoform 4
NCBI Official Synonym Full Names
autophagy related 16 like 1
NCBI Official Symbol
ATG16L1
NCBI Official Synonym Symbols
IBD10; WDR30; APG16L; ATG16A; ATG16L
NCBI Protein Information
autophagy-related protein 16-1
UniProt Protein Name
Autophagy-related protein 16-1
Protein Family
UniProt Gene Name
ATG16L1
UniProt Synonym Gene Names
APG16L
UniProt Entry Name
A16L1_HUMAN

NCBI Description

The protein encoded by this gene is part of a large protein complex that is necessary for autophagy, the major process by which intracellular components are targeted to lysosomes for degradation. Defects in this gene are a cause of susceptibility to inflammatory bowel disease type 10 (IBD10). Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2010]

Uniprot Description

ATG16: Plays an essential role in autophagy. Homooligomer. Interacts with ATG5. Part of either the minor and major complexes respectively composed of 4 sets of ATG12-ATG5 and ATG16L1 (400 kDa) or 8 sets of ATG12-ATG5 and ATG16L1 (800 kDa). Belongs to the WD repeat ATG16 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, peripheral; Adaptor/scaffold; Autophagy

Chromosomal Location of Human Ortholog: 2q37.1

Cellular Component: pre-autophagosomal structure membrane; autophagic vacuole; axoneme

Molecular Function: identical protein binding; protein binding

Biological Process: protein transport; protein homooligomerization; autophagic vacuole formation

Disease: Inflammatory Bowel Disease 10

Research Articles on ATG16L1

Similar Products

Product Notes

The ATG16L1 atg16l1 (Catalog #AAA3211563) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATG16L1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATG16L1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ATG16L1 atg16l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QYNKLLEKSD LHSVLAQKLQ AEKHDVPNRH EISPGHDGTW NDNQLQEMAQ. It is sometimes possible for the material contained within the vial of "ATG16L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.