Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NECAB3 blocking peptide

NECAB3 Peptide - N-terminal region

Gene Names
NECAB3; NIP1; XB51; STIP3; EFCBP3; SYTIP2; APBA2BP; dJ63M2.4; dJ63M2.5
Reactivity
Human
Applications
Western Blot
Synonyms
NECAB3; NECAB3 Peptide - N-terminal region; NECAB3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADK
Sequence Length
396
Applicable Applications for NECAB3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NECAB3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-NECAB3 Antibody, made

Target Description: The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for NECAB3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
N-terminal EF-hand calcium-binding protein 3 isoform 2
NCBI Official Synonym Full Names
N-terminal EF-hand calcium binding protein 3
NCBI Official Symbol
NECAB3
NCBI Official Synonym Symbols
NIP1; XB51; STIP3; EFCBP3; SYTIP2; APBA2BP; dJ63M2.4; dJ63M2.5
NCBI Protein Information
N-terminal EF-hand calcium-binding protein 3
UniProt Protein Name
N-terminal EF-hand calcium-binding protein 3
UniProt Gene Name
NECAB3
UniProt Synonym Gene Names
APBA2BP; NIP1; SYTIP2; XB51
UniProt Entry Name
NECA3_HUMAN

NCBI Description

The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

NECAB3: Inhibits the interaction of APBA2 with beta-amyloid precursor protein (APP), and hence allows formation of beta- amyloid. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 20q11.22

Cellular Component: endoplasmic reticulum membrane; cytoplasm; Golgi cis cisterna; nucleus

Molecular Function: protein binding; calcium ion binding

Biological Process: regulation of amyloid precursor protein biosynthetic process; protein metabolic process; protein secretion

Research Articles on NECAB3

Similar Products

Product Notes

The NECAB3 necab3 (Catalog #AAA3238433) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NECAB3 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NECAB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NECAB3 necab3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MACAGLLTVC LLRPPAPQPQ PQTPRHPQLA PDPGPAGHTL FQDVFRRADK. It is sometimes possible for the material contained within the vial of "NECAB3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.