RHOJ blocking peptide
RHOJ Peptide - middle region
Gene Names
RHOJ; TCL; ARHJ; TC10B; RASL7B
Reactivity
Human
Applications
Western Blot
Synonyms
RHOJ; RHOJ Peptide - middle region; RHOJ blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK
Sequence Length
214
Applicable Applications for RHOJ blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RHOJ blocking peptide
This is a synthetic peptide designed for use in combination with anti-RHOJ Antibody, made
Target Description: ARHJ belongs to the Rho family of small GTP-binding proteins. Rho proteins regulate the dynamic assembly of cytoskeletal components for several physiologic processes, such as cell proliferation and motility and the establishment of cell polarity. They are also involved in pathophysiologic process, such as cell transformation and metastasis.
Target Description: ARHJ belongs to the Rho family of small GTP-binding proteins. Rho proteins regulate the dynamic assembly of cytoskeletal components for several physiologic processes, such as cell proliferation and motility and the establishment of cell polarity. They are also involved in pathophysiologic process, such as cell transformation and metastasis.
Product Categories/Family for RHOJ blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24kDa
NCBI Official Full Name
rho-related GTP-binding protein RhoJ
NCBI Official Synonym Full Names
ras homolog family member J
NCBI Official Symbol
RHOJ
NCBI Official Synonym Symbols
TCL; ARHJ; TC10B; RASL7B
NCBI Protein Information
rho-related GTP-binding protein RhoJ
UniProt Protein Name
Rho-related GTP-binding protein RhoJ
Protein Family
UniProt Gene Name
Rhoj
UniProt Synonym Gene Names
Arhj; Rhoi; Rhot; Tc10l; Tcl
UniProt Entry Name
RHOJ_MOUSE
NCBI Description
This gene encodes one of the many small GTP-binding proteins in the Rho family shown to be associated with focal adhesions in endothelial cells (PMID: 21148427, 22103495). The encoded protein is activated by vascular endothelial growth factor and may regulate angiogenesis. [provided by RefSeq, Dec 2011]
Research Articles on RHOJ
Similar Products
Product Notes
The RHOJ rhoj (Catalog #AAA3238305) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RHOJ Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RHOJ can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RHOJ rhoj for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LGLYDTAGQE DYNQLRPLSY PNTDVFLICF SVVNPASYHN VQEEWVPELK. It is sometimes possible for the material contained within the vial of "RHOJ, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
