LOH11CR2A blocking peptide
LOH11CR2A Peptide - N-terminal region
Gene Names
VWA5A; BCSC1; BCSC-1; LOH11CR2A
Reactivity
Human
Applications
Western Blot
Synonyms
LOH11CR2A; LOH11CR2A Peptide - N-terminal region; LOH11CR2A blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
TLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDV
Sequence Length
786
Applicable Applications for LOH11CR2A blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for LOH11CR2A blocking peptide
LOH11CR2A may play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis.
Product Categories/Family for LOH11CR2A blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
von Willebrand factor A domain-containing protein 5A isoform 1
NCBI Official Synonym Full Names
von Willebrand factor A domain containing 5A
NCBI Official Symbol
VWA5A
NCBI Official Synonym Symbols
BCSC1; BCSC-1; LOH11CR2A
NCBI Protein Information
von Willebrand factor A domain-containing protein 5A
UniProt Protein Name
von Willebrand factor A domain-containing protein 5A
UniProt Gene Name
VWA5A
UniProt Synonym Gene Names
BCSC1; LOH11CR2A; BCSC-1
UniProt Entry Name
VMA5A_HUMAN
Uniprot Description
VWA5A: May play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Tumor suppressor
Chromosomal Location of Human Ortholog: 11q24.1
Cellular Component: nucleoplasm; nucleus
Research Articles on LOH11CR2A
Similar Products
Product Notes
The LOH11CR2A vwa5a (Catalog #AAA3236998) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The LOH11CR2A Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LOH11CR2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LOH11CR2A vwa5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TLSMVATIDS QHGIEKVQSN CPLSPTEYLG EDKTSAQVSL AAGHKFDRDV. It is sometimes possible for the material contained within the vial of "LOH11CR2A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
