Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ETF1 blocking peptide

ETF1 Peptide - N-terminal region

Gene Names
ETF1; ERF; RF1; ERF1; TB3-1; D5S1995; SUP45L1
Reactivity
Human
Applications
Western Blot
Synonyms
ETF1; ETF1 Peptide - N-terminal region; ETF1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL
Sequence Length
437
Applicable Applications for ETF1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ETF1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ETF1 Antibody, made

Target Description: Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP. A class 1 RF recognizes the stop codon and promotes the hydrolysis of the ester bond linking the polypeptide chain with the peptidyl site tRNA, a reaction catalyzed at the peptidyl transferase center of the ribosome. Class 2 RFs, which are not codon specific and do not recognize codons, stimulate class 1 RF activity and confer GTP dependency upon the process. In prokaryotes, both class 1 RFs, RF1 and RF2, recognize UAA; however, UAG and UGA are decoded specifically by RF1 and RF2, respectively. In eukaryotes, eRF1, or ETF1, the functional counterpart of RF1 and RF2, functions as an omnipotent RF, decoding all 3 stop codons (Frolova et al., 1994 [PubMed 7990965]).
Product Categories/Family for ETF1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
eukaryotic peptide chain release factor subunit 1 isoform 1
NCBI Official Synonym Full Names
eukaryotic translation termination factor 1
NCBI Official Symbol
ETF1
NCBI Official Synonym Symbols
ERF; RF1; ERF1; TB3-1; D5S1995; SUP45L1
NCBI Protein Information
eukaryotic peptide chain release factor subunit 1
UniProt Protein Name
Eukaryotic peptide chain release factor subunit 1
UniProt Gene Name
ETF1
UniProt Synonym Gene Names
ERF1; RF1; SUP45L1; Eukaryotic release factor 1; eRF1
UniProt Entry Name
ERF1_HUMAN

NCBI Description

This gene encodes a class-1 polypeptide chain release factor. The encoded protein plays an essential role in directing termination of mRNA translation from the termination codons UAA, UAG and UGA. This protein is a component of the SURF complex which promotes degradation of prematurely terminated mRNAs via the mechanism of nonsense-mediated mRNA decay (NMD). Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 6, 7, and X. [provided by RefSeq, Aug 2013]

Research Articles on ETF1

Similar Products

Product Notes

The ETF1 etf1 (Catalog #AAA3236781) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ETF1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ETF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ETF1 etf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ISLIIPPKDQ ISRVAKMLAD EFGTASNIKS RVNRLSVLGA ITSVQQRLKL. It is sometimes possible for the material contained within the vial of "ETF1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.