Jarid2 blocking peptide
Jarid2 Peptide - middle region
Gene Names
Jarid2; Jmj; jumonji
Reactivity
Mouse
Applications
Western Blot
Synonyms
Jarid2; Jarid2 Peptide - middle region; Jarid2 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
NASSSCQSTPRKGKTHKHVHNGHVFNGSSRSAREKEPAHKHRSKEATPGK
Sequence Length
1234
Applicable Applications for Jarid2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Jarid2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Jarid2 Antibody, made
Target Description: Jarid2 is a regulator of histone methyltransferase complexes that plays an essential role in embryonic development, including heart and liver development, neural tube fusion process and hematopoiesis.Jarid2 acts by modulating histone methyltransferase activity and promoting the recruitment of histone methyltransferase complexes to their target genes.Jarid2 binds DNA and mediates the recruitment of the PRC2 complex to target genes in embryonic stem cells.Jarid2 does not have histone demethylase activity but regulates activity of various histone methyltransferase complexes. In embryonic stem cells, it associates with the PRC2 complex and inhibits trimethylation of 'Lys-27' of histone H3 (H3K27me3) by the PRC2 complex, thereby playing a key role in differentiation of embryonic stem cells and normal development. In cardiac cells, it is required to repress expression of cyclin-D1 (CCND1) by activating methylation of 'Lys-9' of histone H3 (H3K9me) by the GLP1/EHMT1 and G9a/EHMT2 histone methyltransferases.Jarid2 also acts as a transcriptional repressor of ANF via its interaction with GATA4 and NKX2-5.Jarid2 participates in the negative regulation of cell proliferation signaling.
Target Description: Jarid2 is a regulator of histone methyltransferase complexes that plays an essential role in embryonic development, including heart and liver development, neural tube fusion process and hematopoiesis.Jarid2 acts by modulating histone methyltransferase activity and promoting the recruitment of histone methyltransferase complexes to their target genes.Jarid2 binds DNA and mediates the recruitment of the PRC2 complex to target genes in embryonic stem cells.Jarid2 does not have histone demethylase activity but regulates activity of various histone methyltransferase complexes. In embryonic stem cells, it associates with the PRC2 complex and inhibits trimethylation of 'Lys-27' of histone H3 (H3K27me3) by the PRC2 complex, thereby playing a key role in differentiation of embryonic stem cells and normal development. In cardiac cells, it is required to repress expression of cyclin-D1 (CCND1) by activating methylation of 'Lys-9' of histone H3 (H3K9me) by the GLP1/EHMT1 and G9a/EHMT2 histone methyltransferases.Jarid2 also acts as a transcriptional repressor of ANF via its interaction with GATA4 and NKX2-5.Jarid2 participates in the negative regulation of cell proliferation signaling.
Product Categories/Family for Jarid2 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
137kDa
NCBI Official Full Name
protein Jumonji isoform 1
NCBI Official Synonym Full Names
jumonji, AT rich interactive domain 2
NCBI Official Symbol
Jarid2
NCBI Official Synonym Symbols
Jmj; jumonji
NCBI Protein Information
protein Jumonji
UniProt Protein Name
Protein Jumonji
UniProt Gene Name
Jarid2
UniProt Synonym Gene Names
Jmj
UniProt Entry Name
JARD2_MOUSE
Research Articles on Jarid2
Similar Products
Product Notes
The Jarid2 jarid2 (Catalog #AAA3228504) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Jarid2 Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Jarid2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Jarid2 jarid2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NASSSCQSTP RKGKTHKHVH NGHVFNGSSR SAREKEPAHK HRSKEATPGK. It is sometimes possible for the material contained within the vial of "Jarid2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
