Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Nkx3-1 blocking peptide

Nkx3-1 Peptide - middle region

Gene Names
Nkx3-1; Bax; NKX3A; NKX3.1; Nkx-3.1; bagpipe
Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Nkx3-1; Nkx3-1 Peptide - middle region; Nkx3-1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
TPTEPESDAHFETYLLDCEHNPGDLASAPQVTKQPQKRSRAAFSHTQVIE
Sequence Length
237
Applicable Applications for Nkx3-1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Nkx3-1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Nkx3-1 Antibody, made

Target Description: Nkx3-1 is a transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. It plays an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. Nkx3-1 acts as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to suppress growth and tumorigenicity of prostate carcinoma cells and plays a role in the formation of minor salivary glands (particularly palatine and lingual glands). It is essential for appropriate differentiation and secretory function of the bulbourethral gland.
Product Categories/Family for Nkx3-1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
homeobox protein Nkx-3.1
NCBI Official Synonym Full Names
NK3 homeobox 1
NCBI Official Symbol
Nkx3-1
NCBI Official Synonym Symbols
Bax; NKX3A; NKX3.1; Nkx-3.1; bagpipe
NCBI Protein Information
homeobox protein Nkx-3.1
UniProt Protein Name
Homeobox protein Nkx-3.1
Protein Family
UniProt Gene Name
Nkx3-1
UniProt Synonym Gene Names
Nkx-3.1; Nkx3a
UniProt Entry Name
NKX31_MOUSE

Uniprot Description

NKX3-1: Transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. Play an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. Act as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to inhibit proliferation and invasion activities of PC-3 prostate cancer cells. Interacts with serum response factor (SRF). Interacts with SPDEF. Interacts with WDR77. Interacts with TOPORS which polyubiquitinates NKX3-1 and induces its proteasomal degradation. By androgens and, in the LNCAP cell line, by estrogens. Androgenic control may be lost in prostate cancer cells during tumor progression from an androgen-dependent to an androgen- independent phase. Highly expressed in the prostate and, at a lower level, in the testis. Belongs to the NK-3 homeobox family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Tumor suppressor; DNA-binding

Cellular Component: intracellular; nucleus

Molecular Function: protein binding; androgen receptor activity; estrogen receptor activity; DNA binding; protein self-association; sequence-specific DNA binding; histone deacetylase binding; estrogen receptor binding; caspase activator activity; protein kinase activator activity; transcription factor binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; prostate gland development; salivary gland development; positive regulation of transcription, DNA-dependent; multicellular organismal development; negative regulation of insulin-like growth factor receptor signaling pathway; positive regulation of caspase activity; positive regulation of mitotic cell cycle; negative regulation of cell proliferation; regulation of transcription, DNA-dependent; positive regulation of cell proliferation; protein kinase B signaling cascade; negative regulation of mitotic cell cycle; negative regulation of epithelial cell proliferation; caspase activation; transcription, DNA-dependent; response to testosterone stimulus; positive regulation of phosphoinositide 3-kinase cascade; internal genitalia morphogenesis; branching morphogenesis of a tube; positive regulation of protein kinase activity; positive regulation of cell division; androgen receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; positive regulation of protein amino acid phosphorylation; negative regulation of transcription, DNA-dependent; urogenital system development

Research Articles on Nkx3-1

Similar Products

Product Notes

The Nkx3-1 nkx3-1 (Catalog #AAA3228432) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Nkx3-1 Peptide - middle region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Nkx3-1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Nkx3-1 nkx3-1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TPTEPESDAH FETYLLDCEH NPGDLASAPQ VTKQPQKRSR AAFSHTQVIE. It is sometimes possible for the material contained within the vial of "Nkx3-1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.