Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

P2RXL1 blocking peptide

P2RXL1 Peptide - N-terminal region

Gene Names
P2RX6; P2X6; P2XM; P2RXL1
Reactivity
Human
Applications
Western Blot
Synonyms
P2RXL1; P2RXL1 Peptide - N-terminal region; P2RXL1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
NWRVGALQRLLQFGIVVYVVGWALLAKKGYQERDLEPQFSIITKLKGVSV
Sequence Length
441
Applicable Applications for P2RXL1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for P2RXL1 blocking peptide
The protein encoded by this gene belongs to the family of P2X receptors, which are ATP-gated ion channels and mediate rapid and selective permeability to cations. This gene is predominantly expressed in skeletal muscle, and regulated by p53. The encoded protein is associated with VE-cadherin at the adherens junctions of human umbilical vein endothelial cells. Alternative splicing results in multiple transcript variants. A related pseudogene, which is also located on chromosome 22, has been identified.
Product Categories/Family for P2RXL1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
P2X purinoceptor 6 isoform 1
NCBI Official Synonym Full Names
purinergic receptor P2X 6
NCBI Official Symbol
P2RX6
NCBI Official Synonym Symbols
P2X6; P2XM; P2RXL1
NCBI Protein Information
P2X purinoceptor 6
UniProt Protein Name
P2X purinoceptor 6
UniProt Gene Name
P2RX6
UniProt Synonym Gene Names
P2RXL1; P2X6; P2X6
UniProt Entry Name
P2RX6_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of P2X receptors, which are ATP-gated ion channels and mediate rapid and selective permeability to cations. This gene is predominantly expressed in skeletal muscle, and regulated by p53. The encoded protein is associated with VE-cadherin at the adherens junctions of human umbilical vein endothelial cells. Alternative splicing results in multiple transcript variants. A related pseudogene, which is also located on chromosome 22, has been identified. [provided by RefSeq, Apr 2009]

Uniprot Description

P2X6: Receptor for ATP that acts as a ligand-gated ion channel. Belongs to the P2X receptor family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Channel, cation; Receptor, misc.; Channel, ligand-gated

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: cell soma; integral to plasma membrane; postsynaptic density; cytoplasm; dendritic spine; integral to nuclear inner membrane; cell junction

Molecular Function: identical protein binding; transmembrane receptor activity; channel activity; purinergic nucleotide receptor activity; ATP binding; ATP-gated cation channel activity

Biological Process: muscle contraction; transport; protein heterooligomerization; signal transduction; transmembrane transport; protein homooligomerization; cation transport

Research Articles on P2RXL1

Similar Products

Product Notes

The P2RXL1 p2rx6 (Catalog #AAA3227439) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The P2RXL1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's P2RXL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the P2RXL1 p2rx6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NWRVGALQRL LQFGIVVYVV GWALLAKKGY QERDLEPQFS IITKLKGVSV. It is sometimes possible for the material contained within the vial of "P2RXL1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.