Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NFYB blocking peptide

NFYB Peptide - middle region

Gene Names
NFYB; HAP3; CBF-A; CBF-B; NF-YB
Reactivity
Human
Applications
Western Blot
Synonyms
NFYB; NFYB Peptide - middle region; NFYB blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
EAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYT
Sequence Length
207
Applicable Applications for NFYB blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NFYB blocking peptide
This is a synthetic peptide designed for use in combination with anti-NFYB Antibody, made

Target Description: NFYB is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a tight dimer with the C subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants.
Product Categories/Family for NFYB blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
nuclear transcription factor Y subunit beta
NCBI Official Synonym Full Names
nuclear transcription factor Y subunit beta
NCBI Official Symbol
NFYB
NCBI Official Synonym Symbols
HAP3; CBF-A; CBF-B; NF-YB
NCBI Protein Information
nuclear transcription factor Y subunit beta
UniProt Protein Name
Nuclear transcription factor Y subunit beta
UniProt Gene Name
NFYB
UniProt Synonym Gene Names
HAP3; NF-YB
UniProt Entry Name
NFYB_HUMAN

NCBI Description

The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a tight dimer with the C subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants. [provided by RefSeq, Jul 2008]

Uniprot Description

NFYB: Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes. Belongs to the NFYB/HAP3 subunit family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 12q22-q23

Cellular Component: nucleoplasm; CCAAT-binding factor complex; nucleus

Molecular Function: protein binding; DNA binding; sequence-specific DNA binding; protein heterodimerization activity; protein complex binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; cellular lipid metabolic process

Research Articles on NFYB

Similar Products

Product Notes

The NFYB nfyb (Catalog #AAA3225393) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NFYB Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFYB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NFYB nfyb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EAMKGEKGIG GAVTATDGLS EELTEEAFTN QLPAGLITTD GQQQNVMVYT. It is sometimes possible for the material contained within the vial of "NFYB, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.