Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SFRP1 Antibody Titration: 0.3ug/mlELISA Titer: 1:62500Positive Control: Human kidney)

Rabbit SFRP1 Polyclonal Antibody | anti-SFRP1 antibody

SFRP1 antibody - middle region

Gene Names
SFRP1; FRP; FRP1; FrzA; FRP-1; SARP2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
SFRP1; Polyclonal Antibody; SFRP1 antibody - middle region; anti-SFRP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPT
Sequence Length
314
Applicable Applications for anti-SFRP1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SFRP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SFRP1 Antibody Titration: 0.3ug/mlELISA Titer: 1:62500Positive Control: Human kidney)

Western Blot (WB) (WB Suggested Anti-SFRP1 Antibody Titration: 0.3ug/mlELISA Titer: 1:62500Positive Control: Human kidney)
Related Product Information for anti-SFRP1 antibody
This is a rabbit polyclonal antibody against SFRP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Secreted frizzled-related protein 1 (SFRP1) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. SFRP1 may be involved in de

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
secreted frizzled-related protein 1
NCBI Official Synonym Full Names
secreted frizzled related protein 1
NCBI Official Symbol
SFRP1
NCBI Official Synonym Symbols
FRP; FRP1; FrzA; FRP-1; SARP2
NCBI Protein Information
secreted frizzled-related protein 1
UniProt Protein Name
Secreted frizzled-related protein 1
UniProt Gene Name
SFRP1
UniProt Synonym Gene Names
FRP; FRP1; SARP2; FRP-1; sFRP-1; SARP-2
UniProt Entry Name
SFRP1_HUMAN

NCBI Description

This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. Members of this family act as soluble modulators of Wnt signaling; epigenetic silencing of SFRP genes leads to deregulated activation of the Wnt-pathway which is associated with cancer. This gene may also be involved in determining the polarity of photoreceptor cells in the retina. [provided by RefSeq, Sep 2009]

Uniprot Description

SFRP1: Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP1 decreases intracellular beta-catenin levels. Has antiproliferative effects on vascular cells, in vitro and in vivo, and can induce, in vivo, an angiogenic response. In vascular cell cycle, delays the G1 phase and entry into the S phase. In kidney development, inhibits tubule formation and bud growth in metanephroi. Inhibits WNT1/WNT4-mediated TCF-dependent transcription. Interacts with WNT1, WNT2 and FRZD6. Interacts with WNT4 and WNT8. Down-regulated in colorectal and breast tumors. Up- regulated in uterine leiomyomas under high estrogenic conditions. Expression, in leiomyomal cells, also increased both under hypoxic and serum deprivation conditions. Widely expressed. Absent from lung, liver and peripheral blood leukocytes. Highest levels in heart and fetal kidney. Also expressed in testis, ovary, fetal brain and lung, leiomyomal cells, myometrial cells and vascular smooth muscle cells. Expressed in foreskin fibroblasts and in keratinocytes. Belongs to the secreted frizzled-related protein (sFRP) family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 8p11.21

Cellular Component: extracellular matrix; extracellular space; proteinaceous extracellular matrix; cell surface; integral to membrane; extracellular region; plasma membrane; intracellular; cytosol

Molecular Function: heparin binding; G-protein coupled receptor activity; identical protein binding; Wnt-protein binding; Wnt receptor activity; protein binding; frizzled binding; cysteine-type endopeptidase activity; drug binding

Biological Process: negative regulation of osteoclast differentiation; negative regulation of Wnt receptor signaling pathway; somatic stem cell maintenance; positive regulation of apoptosis; positive regulation of transcription, DNA-dependent; dorsal/ventral axis specification; Wnt receptor signaling pathway through beta-catenin; proteolysis; response to organic cyclic substance; negative regulation of insulin secretion; negative regulation of BMP signaling pathway; negative regulation of cell proliferation; positive regulation of focal adhesion formation; ureteric bud development; positive regulation of cell proliferation; positive regulation of stress fiber formation; negative regulation of ossification; positive regulation of smoothened signaling pathway; negative regulation of osteoblast differentiation; positive regulation of cell-matrix adhesion; negative regulation of cell migration; positive regulation of Wnt receptor signaling pathway; female gonad development; negative regulation of epithelial cell proliferation; response to drug; negative regulation of B cell differentiation; negative regulation of JNK activity; negative regulation of peptidyl-tyrosine phosphorylation; menstrual cycle phase; male gonad development; digestive tract morphogenesis; cellular response to starvation; positive regulation of cell growth; regulation of angiogenesis; osteoblast differentiation; negative regulation of fibroblast proliferation; neural tube closure; negative regulation of bone remodeling; positive regulation of fat cell differentiation; negative regulation of osteoblast proliferation; hemopoietic progenitor cell differentiation; neural crest cell fate commitment; negative regulation of cell growth; negative regulation of transcription, DNA-dependent; positive regulation of epithelial cell proliferation; negative regulation of apoptosis

Research Articles on SFRP1

Similar Products

Product Notes

The SFRP1 sfrp1 (Catalog #AAA3224457) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SFRP1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SFRP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SFRP1 sfrp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HQLDNLSHHF LIMGRKVKSQ YLLTAIHKWD KKNKEFKNFM KKMKNHECPT. It is sometimes possible for the material contained within the vial of "SFRP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.