Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MDM4 AntibodyTitration: 2.5 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit MDM4 Polyclonal Antibody | anti-MDM4 antibody

MDM4 antibody - N-terminal region

Gene Names
MDM4; HDMX; MDMX; MRP1
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Protein A purified
Synonyms
MDM4; Polyclonal Antibody; MDM4 antibody - N-terminal region; anti-MDM4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSAEESSTSRKRT
Sequence Length
490
Applicable Applications for anti-MDM4 antibody
Western Blot (WB)
Homology
Cow: 80%; Dog: 93%; Horse: 93%; Human: 100%; Pig: 86%; Rabbit: 80%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MDM4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MDM4 AntibodyTitration: 2.5 ug/mlPositive Control: HepG2 Whole Cell)

Western Blot (WB) (WB Suggested Anti-MDM4 AntibodyTitration: 2.5 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-MDM4 antibody
This is a rabbit polyclonal antibody against MDM4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MDM4 inhibits p53- and p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. inhibits degradation of MDM2. It can reverse MDM2-targeted degradation of p53 while maintaining suppression of p53 transactivation and apoptotic functions.The human MDM4 gene, which plays a role in apoptosis, encodes a 490-amino acid protein containing a RING finger domain and a putative nuclear localization signal. The MDM4 putative nuclear localization signal, which all Mdm proteins contain, is located in the C-terminal region of the protein. The mRNA is expressed at a high level in thymus and at lower levels in all other tissues tested. MDM4 protein produced by in vitro translation interacts with p53 via a binding domain located in the N-terminal region of the MDM4 protein. MDM4 shows significant structural similarity to p53-binding protein MDM2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
protein Mdm4 isoform 1
NCBI Official Synonym Full Names
MDM4 regulator of p53
NCBI Official Symbol
MDM4
NCBI Official Synonym Symbols
HDMX; MDMX; MRP1
NCBI Protein Information
protein Mdm4
UniProt Protein Name
Protein Mdm4
Protein Family
UniProt Gene Name
MDM4
UniProt Synonym Gene Names
MDMX
UniProt Entry Name
MDM4_HUMAN

NCBI Description

This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Feb 2011]

Uniprot Description

MDM4: Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions. Interacts with MDM2, TP53, TP73 and USP2. Found in a trimeric complex with UPB2, MDM2 and MDM4. Interacts (phosphorylated) with YWHAG; negatively regulates MDM4 activity toward TP53. Down-regulated by cisplatin. Expressed in all tissues tested with high levels in thymus. Belongs to the MDM2/MDM4 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; Ubiquitin ligase; EC 6.3.2.-; Ligase

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; enzyme binding; zinc ion binding

Biological Process: cell proliferation; negative regulation of cell proliferation; protein stabilization; DNA damage response, signal transduction by p53 class mediator; G0 to G1 transition; positive regulation of cell proliferation; protein complex assembly; negative regulation of transcription from RNA polymerase II promoter; negative regulation of protein catabolic process; negative regulation of apoptosis

Research Articles on MDM4

Similar Products

Product Notes

The MDM4 mdm4 (Catalog #AAA3224405) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MDM4 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's MDM4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MDM4 mdm4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLRKNLVTLA TATTDAAQTL ALAQDHSMDI PSQDQLKQSA EESSTSRKRT. It is sometimes possible for the material contained within the vial of "MDM4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.