Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TNFRSF10C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)

Rabbit anti-Human TNFRSF10C Polyclonal Antibody | anti-TNFRSF10C antibody

TNFRSF10C antibody - N-terminal region

Gene Names
TNFRSF10C; LIT; DCR1; TRID; CD263; TRAILR3; TRAIL-R3; DCR1-TNFR
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TNFRSF10C; Polyclonal Antibody; TNFRSF10C antibody - N-terminal region; anti-TNFRSF10C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKG
Sequence Length
259
Applicable Applications for anti-TNFRSF10C antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF10C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TNFRSF10C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)

Western Blot (WB) (WB Suggested Anti-TNFRSF10C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)
Related Product Information for anti-TNFRSF10C antibody
This is a rabbit polyclonal antibody against TNFRSF10C. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TNFRSF10C is the receptor for the cytotoxic ligand TRAIL. TNFRSF10C lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. TNFRSF10C may protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 10C
NCBI Official Synonym Full Names
TNF receptor superfamily member 10c
NCBI Official Symbol
TNFRSF10C
NCBI Official Synonym Symbols
LIT; DCR1; TRID; CD263; TRAILR3; TRAIL-R3; DCR1-TNFR
NCBI Protein Information
tumor necrosis factor receptor superfamily member 10C
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 10C
UniProt Gene Name
TNFRSF10C
UniProt Synonym Gene Names
DCR1; LIT; TRAILR3; TRID; DcR1; TRAIL receptor 3; TRAIL-R3
UniProt Entry Name
TR10C_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL. [provided by RefSeq, Jul 2008]

Uniprot Description

TRAIL-R3: Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand. Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 8p22-p21

Cellular Component: integral to plasma membrane

Molecular Function: transmembrane receptor activity; TRAIL binding

Biological Process: apoptosis; signal transduction

Research Articles on TNFRSF10C

Similar Products

Product Notes

The TNFRSF10C tnfrsf10c (Catalog #AAA3224350) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFRSF10C antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNFRSF10C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNFRSF10C tnfrsf10c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MARIPKTLKF VVVIVAVLLP VLAYSATTAR QEEVPQQTVA PQQQRHSFKG. It is sometimes possible for the material contained within the vial of "TNFRSF10C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.