Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ICAM1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ICAM1 Polyclonal Antibody | anti-ICAM1 antibody

ICAM1 Antibody - middle region

Gene Names
ICAM1; BB2; CD54; P3.58
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ICAM1; Polyclonal Antibody; ICAM1 Antibody - middle region; anti-ICAM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPM
Sequence Length
532
Applicable Applications for anti-ICAM1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ICAM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ICAM1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ICAM1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ICAM1 antibody
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation.
Product Categories/Family for anti-ICAM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
intercellular adhesion molecule 1
NCBI Official Synonym Full Names
intercellular adhesion molecule 1
NCBI Official Symbol
ICAM1
NCBI Official Synonym Symbols
BB2; CD54; P3.58
NCBI Protein Information
intercellular adhesion molecule 1
UniProt Protein Name
Intercellular adhesion molecule 1
UniProt Gene Name
ICAM1
UniProt Synonym Gene Names
ICAM-1
UniProt Entry Name
ICAM1_HUMAN

NCBI Description

This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. [provided by RefSeq, Jul 2008]

Uniprot Description

ICAM1: a type I membrane protein of the immunoglobulin superfamily. Is a ligand for the leukocyte adhesion LFA-1 protein (Integrin alpha-L/beta-2) and a Rhinovirus receptor. Typically expressed on endothelial cells and cells of the immune system. ICAM1 binds to integrins of type CD11a / CD18, or CD11b / CD18. Its expression is activated by p53 in an NF-kappaB-independent manner. Induced by TNFalpha in a process that involves IKKbeta.

Protein type: Cell adhesion; Membrane protein, integral; Immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 19p13.3-p13.2

Cellular Component: extracellular space; cell surface; focal adhesion; membrane; integral to plasma membrane; plasma membrane; immunological synapse; external side of plasma membrane

Molecular Function: integrin binding; viral receptor activity; protein binding; transmembrane receptor activity; receptor activity

Biological Process: entry of virus into host cell; extracellular matrix organization and biogenesis; positive regulation of nitric oxide biosynthetic process; T cell antigen processing and presentation; response to organic cyclic substance; activation of NF-kappaB transcription factor; positive regulation of cellular extravasation; regulation of cell shape; leukocyte adhesion; cellular response to nutrient levels; sensory perception of sound; ovarian follicle development; T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell; membrane to membrane docking; response to sulfur dioxide; cell adhesion; regulation of leukocyte mediated cytotoxicity; acute inflammatory response to antigenic stimulus; regulation of cell adhesion; response to drug; virion attachment, binding of host cell surface receptor; regulation of immune response; negative regulation of calcium ion transport; cytokine and chemokine mediated signaling pathway; response to amphetamine; cell aging; response to amino acid stimulus; heterophilic cell adhesion; positive regulation of peptidyl-tyrosine phosphorylation; response to ethanol; response to copper ion; positive regulation of actin filament polymerization; positive regulation of vasoconstriction; cell adhesion mediated by integrin; adhesion to host; response to ionizing radiation; leukocyte migration

Disease: Malaria, Susceptibility To

Research Articles on ICAM1

Similar Products

Product Notes

The ICAM1 icam1 (Catalog #AAA3224125) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ICAM1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ICAM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ICAM1 icam1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSCSATLEVA GQLIHKNQTR ELRVLYGPRL DERDCPGNWT WPENSQQTPM. It is sometimes possible for the material contained within the vial of "ICAM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.